Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29610 productos de "Péptidos"
Aoa-KSKTKC-OH
Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-RLDGNEIKR-NH2
Peptide LCBiot-RLDGNEIKR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VGVAPG-NH2
Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-QGGFLGLSNIK^-OH
Peptide H-QGGFLGLSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2
H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 is a peptide that is involved in tumor targeting. This peptide binds to the integrin αvβ3, which is expressed at high levels on the surface of tumor cells and plays an important role in tumor progression. It has been shown to be able to induce apoptosis in cancer cells and inhibit angiogenesis by binding to the RGD motif on integrins. H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 also inhibits cell proliferation and induces cell cycle arrest.Fórmula:C35H58N16O13S2Pureza:Min. 95%Peso molecular:975.08 g/molH-Glu(Met-OH)-OH
CAS:H-Glu(Met-OH)-OH is an enzyme that catalyzes the conversion of stachyose to sucrose. It is also a synthetase that catalyzes the formation of fatty acids. H-Glu(Met-OH)-OH has been shown to be active in cancer cells and may be used as a potential therapeutic target for cancer treatment. This enzyme is inhibited by sodium hydroxide solution, hydrochloric acid, and urea nitrogen. The activity of H-Glu(Met-OH)-OH is measured by its ability to synthesize fatty acids from glucose in the presence of ATP and NADPH. Hydroxide solution can also be used to measure the activity of H-Glu(Met-OH)-OH as it converts stachyose to sucrose in the presence of ATP, NADP+, and sodium hydroxide solution. The rate at which this reaction occurs can be measured using a spectrophotometer with a carboxylate absorbFórmula:C10H18N2O5SPureza:Min. 95%Forma y color:SolidPeso molecular:278.33 g/molFmoc-PFAV
Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phytosulfokine-α
CAS:Phytosulfokine (PSK) was introduced in 1996 by Matsubayashi and Sakagami of Nagoya University. It is the world's first peptide phytohormone to be isolated from asparagus culture medium. Tyr undergoes post-translational sulfation modification, which is essential for bioactivity. As an example of oxidative peptides showing bioactivity, in animals, CCK-octapeptide (26-33) (sulfated form), PCK-4100-V, CCK-33 (Human), PCK-4201-S and CCK-33 (Porcine), PCK-4176-S are known, but they were first found in plants. The functions of phytosulfokine are i) plant cell proliferation and differentiation activity acting at nanomolar concentrations ii) chlorophyll synthesis-promoting activityiii) formation of adventitious roots and buds iv) adventitious embryogenesisv) involvement in disease resistance The active expression of these PSKs is accompanied by membrane-bound LRR receptors, which are PSK receptors. Leucine-rich repeat receptor-like kinase is involved.
Fórmula:C33H46N6O16S2Pureza:Min. 95%Peso molecular:846.88 g/molHXB2 gag NO-95/aa377 - 391
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,906.3 g/molAmyloid beta peptide(1-40) trifluoroxalate - synthetic
CAS:Amyloid beta peptide (Aβ) is a neurotrophic factor that is involved in the pathogenic mechanism of Alzheimer's disease. This drug inhibits the production of Aβ by binding to the enzyme, secretase. It has been shown that Aβ binds to a transporter protein and is transported into cells, where it accumulates in the cytoplasm. The physiological levels of Aβ are regulated by proteins called "gene chaperones" which prevent Aβ from aggregating into plaques. Dextran sulfate inhibits this process by binding to amyloid and preventing it from accumulating in the cytoplasm. Amyloid beta peptide trifluoroxalate (ATFX) has been shown to inhibit the production of Aβ with structural analysis, inhibition of cellular uptake and secretion, and inhibition of fibrillization. ATFX also has potential as a biomarker for Alzheimer's disease because it can be detected at low concentrations in urine or serumFórmula:C194H295N53O58S·C2HF3O2Pureza:Min. 95%Forma y color:White PowderPeso molecular:4,443.83 g/molH-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used in peptide synthesis. It is a thiol-reactive resin with a pendant amine group. H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is soluble in common organic solvents and can be used for the synthesis of peptides with amino acids containing aromatic rings.Pureza:Min. 95%H-Met-Pro-OH·HCl
CAS:Please enquire for more information about H-Met-Pro-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C10H18N2O3S•HClPureza:Min. 95%Forma y color:PowderPeso molecular:282.79 g/molSIVmac239 - 106
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,688 g/molH-Met-Gly-Pro-AMC·HCl
CAS:H-Met-Gly-Pro-AMC·HCl is a complex organic compound. It is often used as a reagent in organic synthesis, as well as being a useful intermediate for the production of other fine chemicals. H-Met-Gly-Pro-AMC·HCl is useful for producing speciality chemicals and research chemicals, and can be used as a versatile building block.Fórmula:C22H28N4O5S·HClPureza:Min. 97 Area-%Forma y color:PowderPeso molecular:497.01 g/molH-TLQALEFHTVPFQLLAR^-OH
Peptide H-TLQALEFHTVPFQLLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Gly-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Gly-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used as an amine or thiol in peptide synthesis. It is also used as a tool for the synthesis of alcohols and resins.
Pureza:Min. 95%H-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phe4,9 [Ring D5]-Hepcidin (Rat)
A Deuterium Stable Isotope-Labeled Hepcidin for use as an internal standard and in the study of the biological activity of Hepcidin. This product consists of the disulfide bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, and Cys14-Cys22.Fórmula:C111H161D10N29O34S8Pureza:Min. 95%Peso molecular:2,722.37 g/molAc-Leu-Pro-N-Me-Phe-Phe-Asp-NH2
Ac-Leu-Pro-N-Me-Phe-Phe-Asp-NH2 is a peptide that inhibits amyloid beta protein related peptides. It has been shown to inhibit the fibrillogenesis of amyloid beta, which is the main cause of Alzheimer's Disease. Ac-Leu-Pro-N-Me-Phe-Phe-Asp NH2 also has neuroprotective effects by reducing the accumulation of amyloid beta in neuronal cells.Fórmula:C36H48N6O8Pureza:Min. 95%Peso molecular:692.82 g/molH-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C190H288N54O57Peso molecular:4,240.7 g/molMBP (63-81)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,645.1 g/molH-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C192H295N61O60SPeso molecular:4,449.9 g/molH-STELLIRK^-OH
Peptide H-STELLIRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Cys(Xan)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Cys(Xan)-Wang Resin (100-200 mesh) 1% DVB is a research tool used in the synthesis of peptides. It is an inhibitor that blocks the activity of the protein tyrosine phosphatase, which plays a role in the regulation of cell proliferation and differentiation. This resin can be used to produce peptides with cysteine residues that are important for binding to receptors or ion channels. Fmoc-Cys(Xan)-Wang Resin (100-200 mesh) 1% DVB can also be used as a ligand to activate receptors or ion channels. The resin has a purity of 99% and contains less than 0.1% water, so it is suitable for use in research on proteins and cells.
Pureza:Min. 95%Hepcidin (canine)
This product is a Liver-Expressed Antimicrobial Peptide of Canine source containing the disulfide Bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, and Cys14-Cys22. Hepcidin is a peptide hormone that controls the release of iron from storage cells in the liver. It inhibits erythropoiesis by limiting the availability of iron for red blood cell production. This peptide also exhibits anti-microbial properties in that in response to inflammatory cytokines hepcidin leads to a decreased release of iron from enterocytes, hepatocytes and macrophages and further leads to ferroportin degradation and internalization. This product may be useful for use in research into disorders where iron dysregulation is paramount for pathogenesis and also in inflammatory diseases.Pureza:Min. 95%Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)]
Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)] is a peptide macrocycle that is known to bind to integrin and be active against cancer cells. It has been shown to inhibit the growth of cancer cells by inhibiting cell adhesion, which leads to a reduction in the production of biochemicals such as fibronectin. Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)] binds strongly to the integrin receptor on the surface of many types of cancer cells, including those that are resistant to conventional chemotherapy drugs. This peptide macrocycle also inhibits proteolytic cleavage by metalloproteinases and enhances tumor vascularization, making it an attractive candidate for use in cancer treatment.Fórmula:C37H55N11O9SPureza:Min. 95%Peso molecular:829.98 g/molH-GFYPSDIAV^EWESNGQPENNYK^-OH
Peptide H-GFYPSDIAV^EWESNGQPENNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NAVEVLKR^-OH
Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β-Amyloid (1-15)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C78H107N25O27Peso molecular:1,826.87 g/molgp100 (86-95)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Aoa-KFERQ-OH
Peptide Aoa-KFERQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGVEVLEVK^-OH
Peptide H-GGVEVLEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CFTR (108-117), Pseudomonas aeruginosa Inhibitor
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C51H77N15O22Peso molecular:1,252.27 g/molH-ADEGISFR^-OH
Peptide H-ADEGISFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VDNDENEHQLSLR^-OH
Peptide H-VDNDENEHQLSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Gastrin I, human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C97H125N20O31SPeso molecular:2,098.22 g/molH-VEEVSLRK^-OH
Peptide H-VEEVSLRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FPETVLAR^-OH
Peptide H-FPETVLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-S^LSLSPGK-OH
Peptide H-S^LSLSPGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NLQEILHGAVR^-OH
Peptide H-NLQEILHGAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LMP2 (340-350), SSC
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,111.3 g/molH-ATLTLVSQETR^-OH
Peptide H-ATLTLVSQETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIRPP^YPSY-OH
Peptide H-SIRPP^YPSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-I^GHPAPNFK^-OH
Peptide H-I^GHPAPNFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSEPA^^ELTDA^^VK-OH
Peptide H-LSEPA^^ELTDA^^VK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTFIIDPGGVIR^-OH
Peptide H-GTFIIDPGGVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 115 (KAESTVAPEEDTDED)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,635.6 g/molH-SGFSSVSVSR^-OH
Peptide H-SGFSSVSVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MDSRELALASLMC-NH2 PAB-405-1336E
Peptide H-MDSRELALASLMC-NH2 PAB-405-1336E is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-RRR-OH
Peptide Boc-RRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FRGD-3762-PI.webp&w=3840&q=75)
![Phe4,9 [Ring D5]-Hepcidin (Rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPLP-3780-PI.webp&w=3840&q=75)
![Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3895-PI.webp&w=3840&q=75)
