Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29635 productos de "Péptidos"
H-ADSSPVK^-OH
Peptide H-ADSSPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CKSKKFRRPDIQYPD-NH2 000-000-404
Peptide H-CKSKKFRRPDIQYPD-NH2 000-000-404 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGAGGVGK^-OH
Peptide H-LVVVGAGGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PKYVKQNTLKLAT-NH2
Peptide Ac-PKYVKQNTLKLAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-19/aa73 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,775 g/molMitocryptide-1 (MCT-1) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAzidoPEG4-WNPDDYGGVK-NH2
Peptide AzidoPEG4-WNPDDYGGVK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-EPFWEDQ-EDDnp
Peptide Abz-EPFWEDQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAFGEATLYR^-OH
Peptide H-GAFGEATLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotin-GLP-1 (7-36)
The native form of GLP-1 in humans is the GLP-1 (7-36) amide. GLP-1 (7-36) amide is highly unstable (half-life <-2 minutes) due to proteolytic degradation by the serine protease, dipeptidyl peptidase-IV (DPP-IV). DPP-IV cleaves the N-terminal histidine and alanine residues from GLP-1 to generate two equipotent forms: GLP-1 (9-37) and GLP-1 (9-36) amide. This degradation mitigates against the therapeutic use of GLP-1 itself, therefore DPP-IV-resistant peptide analogues have been developed and licensed for clinical use. Contains an N-terminal biotin tag for easy detection and purification.
Forma y color:PowderPeso molecular:3,521.7 g/molH-GSLQKR^GIVE-OH
Peptide H-GSLQKR^GIVE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.EBV LMP2 356-364 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-GDGPVQGIINFEQK^-OH
Peptide H-GDGPVQGIINFEQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDVAFVK^-OH
Peptide H-GDVAFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-2Dk polyomavirus MT peptide RRLGRTLLL
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolTyrosyl-prolyl-tryptophyl-threonine
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C29H35N5O7Peso molecular:565.6 g/molMART-1 (27-35) (human)
CAS:Tumour antigens recognised by cytotoxic T cells (CTLs) are a keen area of research to develop antigen-specific cancer therapies. However, hurdles are weak immunogenicity and high rates of degradation in vivo. In the search for a melanoma vaccine, the human tumour antigen Melan-A/MART-1 (27-35) has been used as a model to design peptides with improved characteristics for use in anti-tumour vaccines. The epitope can induce the production of melanoma-specific CD8+ T-cell responses. It has been included in melanoma antigen peptide vaccines, clinical trial data suggest that MART-1 (27-35) in human systems alongside other epitopes does affect the cellular and humoral responses, but much more work is required with this peptide to optimise it for clinical efficacy against melanoma.An alternate route that is possible but less studied is using MART-1 (27-35) to isolate CD8(+) T-cell clones with greater recognition for the epitope due to the contact with the T-cell receptor. This suggests melanomas could be targeted by optimising the T-cell receptor-peptide recognition of the T-cell repertoire by enhancing antigen targeting.Fórmula:C37H67N9O11Peso molecular:813.98 g/molH-SL^EDLQL^THNK^-OH
Peptide H-SL^EDLQL^THNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 21
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,758.2 g/molCART (Human, 55-102)
CAS:CART is a peptide that acts as an activator for the CART receptor. It has been shown to be a ligand for the CART receptor and blocks calcium channels in cell culture. It is a potent inhibitor of ion channels, which are proteins that allow ions to pass through the membrane of cells. CART is also used as a research tool in cell biology, pharmacology, and life science.Fórmula:C225H365N65O65S7Pureza:Min. 95%Peso molecular:5,245.2 g/molH-RQDNEILIFWSK^-OH
Peptide H-RQDNEILIFWSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.KDAMP
Keratin-Derived anti-microbial Peptides (KDAMPs), are peptide fragment of the intermediate filament protein cytokeratin 6A. They were originally isolated from lysates of human corneal epithelial cells. KDAMPs exhibit coil structures with low α-helical content and are smaller and more stable than other known host-expressed anti-microbials.Multiple length KDAMPs have been studied for their anti-microbial properties, and different fragments show different anti-microbial spectrums. The 19 mer KDAMP peptide is rapidly bactericidal against multiple clinical isolates of Pseudomonas aeruginosa, and shows even greater activity against-Streptococcus pyogenes. However it is not active against Staphylococcus aureus-or-Escherichia coli.
Peso molecular:1,765.9 g/molH-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 120 (HNPAVFTWPPWQAGI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,721 g/molH-VNSQSLSPYLFR^-OH
Peptide H-VNSQSLSPYLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Acetyl Hexapeptide-3
Peptide Acetyl Hexapeptide-3 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 92 (EHPTFTSQYRIQGKL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,805 g/molH-VYKPSAGNNSLYR^-OH
Peptide H-VYKPSAGNNSLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MDYKDHDGDYKDHDIDYKDDDDK-NH2
Peptide H-MDYKDHDGDYKDHDIDYKDDDDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 64 (DLTMTRNPQPFMRPH)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,841.2 g/molLL-17-29
Residues 17-29 of the LL-37 peptide, also known as FK-13. FK-13 has near-similar anti-microbial and anti-cancer properties to LL-37. This core fragment also contains part of the LL-37 actin binding domain and can associate weakly with actin, actin binding protects this fragment from protease degradation.LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37- this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into several different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also has anti-cancer properties and regulates many aspects of the innate immune system- overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis.Peso molecular:1,719.09 g/molMotilin (human, porcine)
Peptide derived from the gastrointestinal hormone Motilin, secreted from endocrine cells in the small intestines, mainly from the jejunum and duodenum, in response to the fasting, drinking water or the mechanical stimulus of eating.Peso molecular:2,697.4 g/molLactacystin
CAS:Lactacystin is a peptide that acts as an activator of ion channels. It binds to the receptor and activates the ligand-gated ion channel, which then opens the ion channel. This leads to increased influx of ions into the cell and an increase in intracellular calcium concentration. Lactacystin has been used as a research tool for studies on protein interactions, such as antibody-antigen interactions and receptor-ligand interactions. Lactacystin is also used for pharmacological purposes, such as for pain relief or for treatment of epilepsy.Fórmula:C15H24N2O7SPureza:Min. 95%Peso molecular:376.43 g/molH-FGESEQIIVTR^-OH
Peptide H-FGESEQIIVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Apelin (65-76), human
Apelin (65-76), human is derived from the apelin peptide which acts as a ligand for the apelin receptor (APJ) G protein coupled receptor and is a substrate for angiotensin converting enzyme 2. Preprapelin, encoded for by APLN located on Xq25-26.1, is cleaved to form either apelin 36 or apelin 17, 12 and 13. As a member of the adipokine hormone family, which are involved in processes such as vascular homeostasis and angiogenesis, the apelin is secreted from adipose tissue.Apelin has been found to be expressed in the spinal cord and the human brain and when performing immunohistochemistry it was observed that apelin-17 is significantly expressed in the human heart, brain, lungs and endothelial cells.Both apelin and the apelin receptor are widely distributed around the body thus apelin has been found to be associated with cardiovascular diseases, obesity, diabetes and cancer. Studies exploring myocardial infarction showed there to be greater apelin mRNA expression during human heart failure compared to in healthy tissue. Apelin protects against heart failure due to, the pyroglutamyl form of apelin, playing a role in decreasing infarct size of myocardial infarctions. Furthermore in rats with hypertension, the expression of apelin and APJ was decreased.Peso molecular:1,402.8 g/molHBV HBsAg 190-197 (H-2 Kb)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Mage-1 Antigen (161-169), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C41H57N11O17Peso molecular:975.97 g/molBz-EYY-NH2
Peptide Bz-EYY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADDGRPFPQVIK^-OH
Peptide H-ADDGRPFPQVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAVDPLLAL^-OH
Peptide H-GAVDPLLAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-D-Glu(OBzl)-OH
CAS:Boc-D-Glu(OBzl)-OH is a potent and selective activator of the D2 dopamine receptor. It binds to the D2 receptor with high affinity and specificity. Boc-D-Glu(OBzl)-OH will protect against D2 receptor desensitization and downregulation, which are common side effects that occur when the D2 receptor is overstimulated by other ligands. Boc-D-Glu(OBzl)-OH may also be useful as a pharmacological tool in studying the function of the D2 receptor in cell biology, cancer research, immunology, and neuropharmacology.
Fórmula:C17H23NO6Pureza:Min. 95%Peso molecular:337.37 g/molH-EIVDSYLPVILDIIK^-OH
Peptide H-EIVDSYLPVILDIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MYH9 741-749 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-VDPVNFK^-OH
Peptide H-VDPVNFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Abz-GVV-OH
Peptide Abz-GVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VIQELGLDK^-OH
Peptide H-VIQELGLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neurotensin
Neurotensin (NT) is involved in food absorption in the gut as well as acting as a neurotransmitter in the central nervous system (CNS). In the intestine, NT increases fatty acid translocation, in part by increasing intestinal blood flow. In the CNS, NT regulates pathways associated with ghrelin and leptin which mediate satiety and food ingestion. NT is also involved in the regulation of Luteinizing hormone (LH) and Prolactin release and also plays a role in hypotension- analgesia- gut contraction- vascular permeability- maintaining energy homeostasis- fat storage and metabolic disorders. Higher plasma pro-NT levels are associated with obesity and insulin resistance. NT is therefore a potential target for treating obesity-related diseases.NT is secreted from neuroendocrine cells in the small intestine upon fat intake and exerts its physiological actions by binding three NT receptor (NTR) types- NTR1, NTR2, and NTR3.NTR1 is highly expressed in various tumour cells including- small cell carcinoma/small cell lung cancer (SCLC)- meningiomas- astrocytomas- glioblastoma- pancreatic and colonic carcinoma, and breast and prostate cancers. NTR1 is therefore a possible target for novel cancer therapy.
Peso molecular:1,801 g/molEndothelin-1 (Human) Antiserum
Endothelin-1 (ET-1) is a peptide hormone that stimulates the release of catecholamines from the adrenal medulla, and acts as a vasoconstrictor. ET-1 is a potent activator of endothelin receptor type A (ETA), which causes vasoconstriction and bronchoconstriction. The antibody recognizes human ET-1 and does not cross react with other endothelin peptides. This antibody can be used for the detection of ET-1 in tissues or cell culture supernatants. It can also be used to purify recombinant human endothelin or ET receptor subtypes.Pureza:Min. 95%
