Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29634 productos de "Péptidos"
Adrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Fórmula:C67H112N16O25Peso molecular:1,541.73 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C57H72N14O8Pureza:Min. 95%Peso molecular:1,081.27 g/molRef: 3D-FD108769
Producto descatalogado[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Fórmula:C216H343N67O60Peso molecular:4,838.43 g/molH-Thr-Asp-OH TFA salt
CAS:Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C8H14N2O6C2F3HO2Pureza:Min. 95%Peso molecular:348.23 g/molRef: 3D-FT108183
Producto descatalogadoIL34 Human, His
IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Pureza:Min 85% By Sds-Page.[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Fórmula:C63H98N16O23S3Peso molecular:1,543.77 g/molProinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Fórmula:C153H259N49O52Peso molecular:3,616.98 g/molP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Fórmula:C65H116N16O17Peso molecular:1,393.75 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Fórmula:C44H67N15O13S2Peso molecular:1,078.25 g/molBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Fórmula:C99H153N29O26S5Peso molecular:2,325.82 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Fórmula:C145H210N42O45Peso molecular:3,261.54 g/molZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C36H39F3N6O13SPureza:Min. 95%Peso molecular:852.79 g/molRef: 3D-FA110597
Producto descatalogadoPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Fórmula:C54H103NO7SPureza:Min. 95%Peso molecular:910.46 g/molRef: 3D-FP107899
Producto descatalogadoIntermedin (rat)
Catalogue peptide; min. 95% purity
Fórmula:C226H361N75O64S2Peso molecular:5,216.99 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Fórmula:C118H177N35O29S•C2HO2F3Pureza:Min. 95%Forma y color:PowderPeso molecular:2,695.98 g/molRef: 3D-FM109206
Producto descatalogadoBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Fórmula:C94H159N31O20S2Peso molecular:2,139.48 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Fórmula:C147H227N39O43SPeso molecular:3,260.75 g/molInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Fórmula:C72H107N19O24Peso molecular:1,622.77 g/molPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Fórmula:C59H104N22O20Peso molecular:1,441.62 g/mol[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Fórmula:C63H103N25O19Peso molecular:1,514.68 g/molSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Fórmula:C59H82N14O18Peso molecular:1,275.4 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Fórmula:C66H109N23O23Peso molecular:1,592.74 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Producto descatalogadoAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderPeso molecular:855 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
