
Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 30316 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Biotin phosphorylated CDK7 (157-169)
<p>Cyclin-dependent kinases (CDKs) are a family of kinases that regulate the cell cycle and gene transcription. Cyclin-dependent kinase 7 (CDK7) forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK) and promotes cell cycle progression. CDK7 is an essential component of the transcription factor TFIIH, involved in DNA repair. CDK7 is also implicated in mRNA processing, transcription activation, pause induction, and pause release.Cyclin-dependent kinases play key roles in cancer development and metastasis. CDK7 is over expressed in many types of cancer such as breast cancer and renal cell carcinoma (RCC). High CDK7 expression is often seen in more advanced stage tumours, is associated with poor prognosis and is correlated with poor response to endocrine treatment. This peptide contains an N-terminal biotin tag for simple detection and purification.</p>Forma y color:PowderPeso molecular:1,672.7 g/mol[5-FAM] Antennapedia peptide amide
<p>Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK), named penetratin, and used in several studies to aid entry of fusion proteins into cells.The full 60 amino acid homeodomain was fused to a T cell epitope of the influenza nucleoprotein and successfully internalised into T cells for presentation. The fragment known as penetratin was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events. Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the CPP. Penetratin is provided here as a C-terminal amide with a C-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag often preferred over FITC due to its high stability- absorbance 492 (nm), 518 emission (nm).</p>Peso molecular:2,604.04 g/molLCBiot-KQPADGNPDPNANPNVDPN-NH2
<p>Peptide LCBiot-KQPADGNPDPNANPNVDPN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>DNA damage-binding protein 2 (DDB2)-[Cys(AF647)]-amide
<p>DNA damage-binding protein 2 is able to recognise and bind to UV-induced DNA lesions and facilitates efficient recognition by XPC. DDB2 and XPC then initiate global genome nucleotide excision repair (GG-NER) to protect DNA from mutagenesis associated with premature aging and skin cancer. Timely DDB2 dissociation is required for DNA damage handover to XPC and swift progression of the multi-step repair reaction. Damage handover from DDB2 to XPC coincides with the arrival of the TFIIH complex, which further promotes DDB2 dissociation and formation of a stable XPC-TFIIH damage verification complex. DDB2 binds directly to and flips out UV-induced damaged bases to create a more suitable substrate for XPC.The UV-DDB complex is part of a larger E3 ubiquitin-ligase complex (CRL4DDB2), also containing CUL4A, RBX1, and the COP9 signalosome. AF647 dye is a commonly used bright, far-red-fluorescent dye which is pH-insensitive over a wide molar range.</p>Peso molecular:4,023.6 g/molMagainin II
<p>Magainins, also known as PGS (peptide glycine serine) are anti-microbial peptides originally isolated from the skin of the African clawed frog Xenopus laevis, they belong to a large family of amphibian amphipathic alpha-helical cationic anti-microbial peptides (CAMPs). Magainin II is active against a wide spectrum of pathogens including Gram-positive and Gram-negative bacteria, fungi and protozoa and has anti-viral properties. Magainins also displays anti-tumour activities and are known to facilitate wound closure and to reduce inflammation.Magainin peptides act by first binding to and then causing eventual collapse of the membrane. Magainins, carry several positive charges, and interact best with membranes with a negative surface charge, such as bacteria or tumour cells. They are non-toxic to healthy eukaryotic cells which are charge-neutral at their outer membrane. The physical mode of action of these peptides reduces the ability of target organisms to develop resistance to them, suggesting good therapeutic potential.</p>Forma y color:PowderPeso molecular:2,466.9 g/molH-VLTEIIASR^-OH
<p>Peptide H-VLTEIIASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEQSDLSFSK^-OH
Peptide H-SEQSDLSFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-84
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,588 g/molH-DQFPEVYVPTVFENYVADIEVDGK^-OH
<p>Peptide H-DQFPEVYVPTVFENYVADIEVDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Abz-QPMAVVQSVPQ-EDDnp
<p>Peptide Abz-QPMAVVQSVPQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-PVVAESPKKP-OH
<p>Peptide LCBiot-PVVAESPKKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CREB327/active transcription factor CREB-A (113-126) Biotinyl, human
<p>CREB327/active transcription factor CREB-A (113-126) Biotinyl, human.</p>Peso molecular:2,069.2 g/molTAT (47-57)
CAS:<p>Tat (47-57) is a cell penetrating cationic peptide derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). Specifically TAT (47-57) is located within the arginine-rich basic domain 48-60 of the TAT peptide which as a whole has three domains which function to aid HIV through transactivation, DNA binding and nuclear transport. As a cell penetrating peptide (CPP) TAT aids in the cellular uptake of molecules and hence serves a valuable purpose in transduction methods. This property has been demonstrated through its ability of allowing toxins such as the neurotoxin Botulinum neurotoxin Type A, produced by the Clostridium botulinum type A bacteria to penetrate the skin barrier non-invasively. Additionally TAT (47-57) can be used to deliver proteins, fluorophores, chelators and DNA to target cells.</p>Fórmula:C64H118N32O14Forma y color:PowderPeso molecular:1,559.83 g/mol4-Fluorobenzoyl-A20FMDV2
<p>A20FMDV2, a peptide derived from the foot and mouth disease virus, inhibits the epithelial-specific integrin alphavβ6 and here is labelled with 4-fluorobenzoyl as the light version of the PET ligand 4-[18F]Fluorobenzoyl A20FMDV2 which can be used for in vivo imaging.</p>Peso molecular:2,283.3 g/molSuc-LLVY-[AMC]
<p>Fluorogenic substrate peptide of the 20S proteasome. In its intact state this peptide is non-fluorescent, however when aminomethylcoumarin (AMC) is released upon hydrolysation, fluorescence can be detected. This peptide is therefore a useful tool for analysing the activity of the 20S proteasome as well as other chymotrypsin-like proteases and calpains. This peptide is also a substrate for chymase, papain, carboxypeptidase Y, proteinase yscE (kexin) and ingensin.AMC is a fluorescent dye with excitation maxima at around 360 nm and emission maxima at around 450 nm. AMC can be excited with a mercury lamp and observed using a UV filter set.</p>Forma y color:PowderPeso molecular:763.4 g/molH-LANDAAQVK^-OH
<p>Peptide H-LANDAAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CHHHHHH-OH
<p>Peptide Ac-CHHHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>AH1 Sequence (6-14)
<p>The AH1 peptide is a H2-Ld-restricted epitope derived from the sequence of the gp70 envelope protein of the ecotropic mammalian C-type retrovirus, murine leukaemia virus (MuLV, emv-1).The envelope gene products of MuLV are expressed in a variety of tumour cells, including B16 melanoma, lymphomas and leukaemia's. AH1 peptide is a tumour-associated antigen and is highly expressed on CT26 and C51 tumour cells.</p>Forma y color:PowderPeso molecular:1,126.5 g/molAcrAP1
<p>Venom peptidomes and proteomes have yielded significant novel drug discoveries. The non-disulphide bridge peptides (NDBPs) have become a particular focus due to their large range of structures as well as biological activity while retaining high specificity.In scorpion venom A. crassicauda, AcrAP1 was identified as a NDBP. Data shows it has antimicrobial activity against bacteria and yeast while also capable of haemolysing of horse erythrocytes. However, AcrAP1 did not affect the growth of the cancerous cell lines tested. Therefore, this peptide could be a useful model for modification to improve its potency. Furthermore, it may allow researchers to identify specific targets in disease pathways for new drug designs. A significant example of this, bradykinin-potentiating peptide Captopril® manages hypertension and originated from the conserved NDBP family.</p>Peso molecular:1,961.35 g/molSomatostatin 14 (human, rat, mouse, pig, chicken, frog)
<p>Somatostatin-14 (SST-14) is a small cyclic peptide hormone secreted by hypothalamus. SST-14 has several roles including inhibiting the release of several hormones such as- growth hormone (GH), gastrin and gastric acid, insulin and glucagon and the regulation of amyloid β-42. In the brain somatostatin increases body temperature and influences visceral functions (e.g. increased blood pressure, decreased heart rate, prevents sympathetically mediated hyperglycemia and stimulates gastric acid secretion).Somatostatin is also present in an N-terminally extended form, somatostatin-28. In mammals, both somatostatin-14 and 28 originate from the prohormone, prosomatostatin, which is generated after removal of a 24 amino acid signal sequence from the 116 amino acids precursor, preprosomatostatin. Somatostatin-14 and 28 bind with similar affinity to five distinct somatostatin receptor subtypes, sst1 to sst5. These receptors belong to the G-protein coupled seven transmembrane domain receptor family and are related to the urotensin II receptors.</p>Peso molecular:1,636.7 g/molAcrAP2a
<p>Venom peptidomes and proteomes have the potential for significant inroads to novel drug discovery. The non-disulphide bridge peptides (NDBPs) have become a particular focus due to their large range of apparent structures as well biological activity while retaining high specificity.Within the peptidome AcrAP2 was identified in the NDBP as having antimicrobial and bactericidal activity. The nascent peptide contains a predicted hydrophobic region, this was altered to lysine residues generating a hydrophilic region, AcrAP1a. This cationic enhancement markedly increases their antibacterial potency against bacteria and yeast. Furthermore, at all concentrations it inhibited proliferation of the cancer cell lines tested. The duality of AcrAP2a on growth modulation in cancer cell lines as well as having potent antimicrobial activity suggests it is a useful analogue for further research in bacteria and eukaryotes.</p>Peso molecular:2,075.67 g/molHistatin-5
<p>Histatins are histidine rich cationic peptides produced in salivary glands and released into the saliva. The main histatins that make up more than 80% of histatins in saliva are histatin 1, histatin 3 and histatin 5. There are two histatin genes, one which encodes histatin 1, and one that encodes histatin 3, all other histatins are derivatives of these two histatins. Histatin 3 is a precursor of histatin 5, each with distinct roles.Histatin 5 is considered an antimicrobial peptide (AMP) as it has antibacterial activity as has been shown against opportunist infections such as P. aeruginosa, E. coli, and S. aureus. Histatin 5 also has potent anticandidal activity for example against Candida and Leishmania, it is shown to be the strongest antifungal of the histatins. The antifungal activity functions by invasion of the microbe and entry to the mitochondria, histatin 5 then inhibits ATPase activity resulting in rapid depletion and ultimately bacterial cell death/apoptosis. As a salivary peptide, it inhibits Bacteroides gingivalis proteinase clostripain and protease activity microbe implicated in periodontal disease.</p>Forma y color:PowderPeso molecular:3,036.29 g/molSteroid Receptor Coactivator-1 (SRC-1) (686-700)
<p>There are three members of the p160 family of steroid receptor coactivators, SRC-1, SRC-2, and SRC-3. These steroid receptor coactivators control the functional output of numerous genetic programs and serve as pleiotropic rheostats for diverse physiological processes. Coactivator proteins interact with nuclear receptors in a ligand-dependent manner and augment transcription.</p>Peso molecular:1,770 g/molGLP-1 (7-36) amide
CAS:<p>This is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. This peptide, human GLP-1 (7–36), shares the same sequence with preproglucagon (78-107), amide, human.</p>Fórmula:C149H226N40O45Forma y color:PowderPeso molecular:3,297.63 g/molAngiotensin II Antipeptide
<p>An angiotensin II (Ang-II) receptor antagonist, the sequence of the angiotensin II anti-peptide has been derived from the anti-sense mRNA complementary to the human Ang-II mRNA. The anti-peptide shares 50% sequence homology with Ang-II and acts to inhibit some of Ang-II's biological activities.Ang-II is a key signalling peptide of the renin angiotensin system (RAS), which is involved in regulating blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and is widely studied in relation to lifestyle-related diseases. Ang-II is produced from angiotensinogen (AGT) via the intermediate angiotensin I (Ang-I). AGTis cleaved by the aspartyl-protease, renin, to produce Ang-I, which is then cleaved by the dicarboxyl-peptidase angiotensin converting enzyme (ACE). ACE removes a histidine and a leucine, from the C-terminus of Ang-I to form Ang-II.Ang-II exerts its affect by binding to the G-protein-coupled receptors- Ang II type 1 (AT1) and Ang II type 2 (AT2) receptors. Ang-II plays central roles in glucose metabolism and blood pressure. Increased levels of Ang-II have also been associated with Alzheimer's disease, and certain cancers including oesophageal squamous cell carcinoma (ESCC), brain cancers and breast cancer. The effects of Ang-II appear to be supressed by another branch of the RAS- the ACE2/Ang-(1-7)/Mas pathway.</p>Peso molecular:898.5 g/molHistone H3 (1-20)-GG-[Lys(5-FAM)]
<p>Histone H3 (1-20)-GG-[Lys(5-FAM)] is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Histone H3 (1-20)-GG-[Lys(5-FAM)] has a C-terminal GKK linker labelled with 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag. This peptide also has an uncharged C-terminal amide.</p>Peso molecular:2,781.5 g/molFluorescein HLA-A*02:01 HBV core (18-27)
<p>HLA-A*02 is a class I major histocompatibility complex (MHC) allele which is part of the HLA-A group of human major histocompatibility complex (MHC) leukocyte antigens (HLA), found at the HLA-A locus. HLA-A is one of three major types of human MHC class I cell surface receptors. The receptor is a heterodimer, and is composed of a heavy alpha chain and smaller β chain. MHC Class I molecules such as HLA-A are part of a process that presents short polypeptides to the immune system. These polypeptides are typically 7-11 amino acids in length and originate from proteins being expressed by the cell. Cytotoxic T cells in the blood "read" the peptide presented by the complex and should only bind to non-self peptides. If binding occurs, a series of events is initiated culminating in cell death via apoptosis. This peptide corresponds to the Hepatitis B variant (HBV) core sequence which is presented on the MHC class I antigen HLA-A*02 and contains fluorescein, a widely used flourescent dye.</p>Peso molecular:1,537.6 g/molHistone H3 (32-47)
<p>Histone H3 (32-47) is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into a structure known as the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.</p>Peso molecular:1,723 g/molM617
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C112H161N29O28Peso molecular:2,361.68 g/molMOG (35-55) amide Mouse, Rat
<p>Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin (Ig) protein superfamily and is expressed exclusively in the central nervous system (CNS) on the surface of myelin sheaths and oligodendrocyte processes. MOG is expressed at the onset of myelination, and therefore is a potential marker for oligodendrocyte maturation.MOG contains an extracellular domain, a transmembrane domain, a cytoplasmic loop, a membrane-associated region and a cytoplasmic tail. MOG may function as a cell surface receptor or cell adhesion molecule. Fifteen different alternatively spliced isoforms have been detected in humans. These are present either on the cell surface, the endoplasmic reticulum in the endocytic system, or in secreted form.The secreted form of MOG may trigger autoimmunity if released into the cerebrospinal fluid and periphery. MOG is thought to be a key target for auto-antibodies and cell-mediated immune responses in inflammatory demyelinating diseases such as multiple sclerosis (MS) and is therefore widely studied in this field.The MOG (35-55) fragment is the most potent auto-antigenic region of MOG, and the most effective at inducing experimental autoimmune/allergic encephalomyelitis (EAE), an animal model that resembles MS. This peptide has an uncharged C-terminal amide, an acid form is also available in our catalogue.</p>Forma y color:PowderPeso molecular:2,579.3 g/molCMVpp65 - 84 (IRETVELRQYDPVAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,760 g/molAc-KLLKLLLKLLKLLLKLLLKLLK-NH2
Peptide Ac-KLLKLLLKLLKLLLKLLLKLLK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Trp-Asn-Phe-Ala-Gly-Ile-Glu-Ala-Ala-Ala-Ser-Ala-Il
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C68H100N18O21Peso molecular:1,505.63 g/mol[5-FAM]-Tp10
<p>TP10 is an amphipathic cell-penetrating peptide (CPPs) known as transportan 10. Its formation involves the use of a lysine residue to form a chimeric linkage between a mastoparan 21-residue peptide, a wasp venon 14-residue peptide and 6-residues derived from the neuropeptide galanin. Structurally TP10 contains only positively charged amino acids along with 4 lysines and an N-terminus. Therefore it will produce a +5 charge under conditions of a neutral pH. It has been found that TP10 may aid molecules in penetrating through the cell membrane barrier through directly interacting with the lipid bilayer. During these interactions with the membrane TP10 will form an amphipathic α-helix. Consequently TP10 can be used in transduction methods.It contains 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.</p>Peso molecular:2,540.05 g/mol[5-FAM]-EB1
<p>EB1 is a penetratin analogue that was synthesised to be an endosomolytic cell penetrating peptide (CPP). Certain amino acids in the penetratin sequence were replaced with histidine to encourage formation of an alpha helix upon protonation in the acidic endosomes. As a CPP, EB1 has been shown to form a strong interaction with the phospholipid bilayer during insertion with rapid cellular uptake, there is a moderate amount of cell leakage and no significant cytotoxicity. EB1 is provided here as a C-terminal amide with a N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag often preferred due to its high stability absorbance 492 (nm), 518 emission (nm).</p>Peso molecular:3,458.07 g/molOvalbumin (324-340) acetyl/amide, chicken
<p>Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (324-340) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.</p>Peso molecular:1,813.9 g/mol[6-FAM]-Arg8
<p>[6-FAM]-Arg8 is an arginine rich cell penetrating peptide labelled with 6-carboxyfluorescein (6-FAM).</p>Peso molecular:1,623.9 g/molAcein
<p>ACE I is a peptidyl-dipeptidase that has been well studied due to its crucial role in blood pressure regulation- ACE I converts angiotensin II to angiotensin I plus degradation of bradykinin as part of the circulating renin-angiotensin system (RAS). ACE I is involved in age-related neurodegeneration. Deregulation of dopamine is evident in Alzheimer's disease and Parkinson's disease with links to RAS. Acein has been shown to interact with ACE I with high affinity without effecting peptidase activity. Furthermore, acein was shown to stimulate dopamine release from rat brain tissue in vitro and in vivo. The mechanism of action has yet to be uncovered.</p>Peso molecular:932.5 g/molHiBiT tag
<p>NanoLuc (Nluc) is an engineered luciferase protein which was developed from the luciferase of deep-sea shrimp (Oplophorus gracilirostris). This luciferase protein is considerably smaller than firefly or Renilla luciferase yet has higher luminescent intensity.In the NanoBiT assay system the NanoLuc luciferase protein has been separated into a large fragment, LgBiT, and a small fragment. HiBiT has a very similar amino acid sequence to the original small fragment and therefore has high specific affinity for the N-terminal large fragment, LgBiT. When these two fragments interact NanoLuc activity is restored. This system offers a novel alternative to conventional immunoblot analysis for the detection of protein expression when the HiBiT tag is added to the protein of interest and cell lysate is incubated with LgBiT. HiBiT peptide is capable of producing bright and quantitative luminescence through high affinity complementation with an 18 kDa subunit derived from NanoLuc (LgBiT).</p>Forma y color:PowderPeso molecular:1,319.8 g/molH-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C194H295N55O57Peso molecular:4,309.81 g/molbeta-Amyloid (1-40) Human
<p>Amyloid β-peptide (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS.Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Aβ1-40 is a major C terminal variant of amyloid β constituting the most abundant AB peptide in the human brain.</p>Peso molecular:4,329.8 g/molGalanin (2-13) acid
Galanin is a widely distributed neuropeptide in the central nervous system, peripheral regions and endocrine system. Galanin has a role in energy homeostasis- central injections of galanin to the amygdala led to food intake in rats. Galanin also acts in the CNS to inhibit neurotransmitter release, such as acetylcholine. Galanin has been implicated in numerous neurological conditions, including Alzheimer's disease, depression, and epilepsy.Galanin interacts with 3 receptor subtypes, GalR1-3 G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of potassium ions.The galanin active fragment 1-16 has been identified as a highly potent agonist for the galanin receptors. These have become a basis for galanin-based peptides, which are neuroactive. These are being investigated as a potential source for anticonvulsant neuropeptides as a therapeutic for conditions such as epilepsy. A library of galanin fragments has allowed screening of their properties to be assessed and used to generate chimeric peptides. Galanin fragments have different affinities for GalR receptors however, the N-terminal 1-16 have been shown to have a conserved affinity for the receptors. This galanin (2-13) peptide is provided in the acidic form. The amide form is also available in our catalogue.Peso molecular:1,290.7 g/molSARS-CoV-2 NSP13 (426-440)
<p>The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication. NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (426-440) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.</p>Peso molecular:1,681.8 g/molGP33 (1-9)
<p>Peptide derived from GP33, an epitope of the lymphocytic choriomeningitis virus (LCMV) which produces a CD8+ cytotoxic T lymphocyte response.</p>Peso molecular:973.16 g/molBiotin phosphorylated JAK1 substrate peptide
<p>This peptide is phosphorylated by Janus kinase 1 (JAK1) and is an ideal substrate for use in kinase assays. The JAK family of kinases is essential for the signalling of a host of immune modulators in tumour, stromal, and immune cells where they are highly expressed. JAK family proteins mediate the signalling of the interferon (IFN), IL-6, and IL-2 families of cytokines.JAK kinases are associated with cytokine receptors. Cytokine binding to these receptors results in activation of JAK kinases and receptor phosphorylation. Phosphorylated cytokine receptors recruit STAT proteins, which are then phosphorylated by the activated JAK kinases. Phosphorylated STAT proteins form homo- and hetero-dimers that translocate into the nucleus and function as transcription factors.This JAK1 substrate peptide contains an N-terminal Biotin and a phospho-tyrosine residue</p>Forma y color:PowderPeso molecular:2,238.9 g/molbeta-Amyloid (35-25)
<p>This peptide represents the reserve sequence of β-amyloid 25-35 (Aβ 25-35) and is used as an inactive control peptide.Aβ has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer disease (AD) and Down syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.</p>Peso molecular:1,059.6 g/molH-NGFFF-NH2
Peptide H-NGFFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SEN 304
<p>Soluble, oligomeric forms of β-amyloid (Aβ) are neurotoxic and are the primary cause of neuronal injury and cell death in Alzheimer's disease (AD). SEN304 is a powerful inhibitor of Aβ aggregation and toxicity and therefore may be therapeutic for AD. SEN 304 can bind directly to Aβ(1-42), delay β-sheet formation and promote aggregation of toxic oligomers into a nontoxic form.</p>Peso molecular:724.5 g/mol
