
Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 30306 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Cyclo(Arg-Gly-Asp-D-Phe-Cys)
CAS:<p>Cyclo(Arg-Gly-Asp-D-Phe-Cys) is a cyclic peptide that can form stable complexes with platinum. It has been shown to have anticancer activity against cervical cancer cells in tissue culture. Cyclo(Arg-Gly-Asp-D-Phe-Cys) binds to the integrin receptor on the surface of cancer cells, which leads to changes in redox potential, leading to cell death by apoptosis or necrosis. Cyclo(Arg-Gly-Asp-D-Phe-Cys) also has pharmacological properties that make it a good candidate for treatment of cancer.</p>Fórmula:C24H34N8O7SPureza:Min. 95%Peso molecular:578.65 g/molBoc-Lys(Cl-Z)-OH
CAS:<p>Boc-Lys(Cl-Z)-OH is a research tool that belongs to the group of peptides. It is an inhibitor of ion channels and can be used as a pharmacological agent. Boc-Lys(Cl-Z)-OH is an agonist of G protein coupled receptors, which are found on cell membranes. It may also be used to activate receptor tyrosine kinases. Boc-Lys(Cl-Z)-OH is a high purity product with > 99% purity.</p>Fórmula:C19H27N2O6ClPureza:Min. 95%Peso molecular:414.88 g/molZ-Leu-Leu-Leu-H (aldehyde)
CAS:Z-Leu-Leu-Leu-H (aldehyde) is an inhibitor that binds to a receptor and prevents the binding of a ligand. This competitive inhibition is reversible and can be used as a research tool to study protein interactions. The high purity of this product makes it ideal for use in pharmacology, cell biology, and life science research.Fórmula:C26H41N3O5Pureza:Min. 95%Peso molecular:475.62 g/moltrans-Cinnamoyl-Tyr-Pro-Gly-Lys-Phe-NH2
CAS:Trans-Cinnamoyl-Tyr-Pro-Gly-Lys-Phe-NH2 is a cardiac peptide that belongs to the class of PAR4 and PAR1 receptor agonists. It has been shown to be an endogenous agonist of both PAR4 and PAR1 receptors, which are involved in blood pressure regulation. Trans-Cinnamoyl-Tyr-Pro-Gly-Lys-Phe-NH2 has been shown to activate these receptors in vivo, leading to increased blood pressure. Additionally, it has been shown to have a cardioprotective effect by decreasing myocardial infarct size in rats.Fórmula:C40H49N7O7Pureza:Min. 95%Peso molecular:739.88 g/molCaloxin 2A1
CAS:<p>Caloxin 2A1 is a peptide that has been shown to activate the receptor for bradykinin, a peptide hormone that causes vasodilation. The activation of this receptor by Caloxin 2A1 leads to the opening of ion channels in the cell membrane, which causes an influx of calcium ions into the cell. This influx activates enzymes that break down proteins and increases the permeability of blood vessels. Caloxin 2A1 also inhibits ligand-induced activation of phospholipase C. Caloxin 2A1 binds to an antibody against bradykinin, which can be used as a research tool or as a means to measure levels of bradykinin in blood plasma.<br>Caloxin 2A1 has a molecular weight of 543 g/mol and CAS number 350670-85-8.</p>Fórmula:C64H91N19O22Pureza:Min. 95%Peso molecular:1,478.5 g/molE-64-d
CAS:<p>E-64-d is a research tool that is used in cell biology, pharmacology, and biochemistry to study protein interactions. E-64-d is an activator, ligand, or receptor for ion channels and has been shown to inhibit the activity of high purity K+ channels. This peptide binds to the extracellular loop of voltage-gated potassium channels (Kv1.2) and inhibits the opening of these channels by blocking their access to ATP. E-64-d also binds to an antibody as a competitive inhibitor of the antigen binding site on the antibody.</p>Fórmula:C17H30N2O5Pureza:Min. 95%Peso molecular:342.43 g/molEptifibatide
CAS:<p>Eptifibatide is a drug that is used in the treatment of congestive heart failure, acute coronary syndrome and peripheral artery disease. It is a glycoprotein IIb/IIIa inhibitor that binds to integrin receptors on platelets and prevents them from binding to fibrinogen. This prevents blood clotting and reduces the risk of stroke or heart attack. Eptifibatide has been shown to be effective for the treatment of bowel disease, infectious diseases, and experimental models of myocardial infarcts. The drug has significant cytotoxicity, which may be due to its ability to inhibit cell proliferation by blocking protein synthesis at the ribosome level.<br>Eptifibatide has been shown to have a disulfide bond between two cysteine residues located in its amino-terminal region. This bond stabilizes the molecule in solution and ensures that it remains active until it reaches its target site.</p>Fórmula:C35H49N11O9S2Pureza:Min. 95%Peso molecular:831.98 g/molFibronectin Adhesion-Promoting Peptide
CAS:<p>Fibronectin Adhesion-Promoting Peptide is a polyclonal antibody that recognizes fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin promotes cell adhesion and proliferation by binding to collagen. This antibody can be used to detect fibronectin in tissues from patients with cancer. It may also be used as a tool for identifying cancer cells that have metastasized to other sites in the body.</p>Fórmula:C47H74N16O10Pureza:Min. 95%Peso molecular:1,023.22 g/molAc-Arg-Gly-Lys-MCA
CAS:<p>Ac-Arg-Gly-Lys-MCA is a histone deacetylase inhibitor that belongs to the class of peptides. This drug has been shown to inhibit the activity of histone deacetylases and can be used for the treatment of diabetes. Ac-Arg-Gly-Lys-MCA is an enzyme substrate, which means it is not active when taken orally. It must be administered intravenously or intraperitoneally in order to be metabolized by enzymes in the body.</p>Fórmula:C26H38N8O6Pureza:Min. 95%Peso molecular:558.63 g/molPyr-Arg-Thr-Lys-Arg-MCA
CAS:<p>MCA conjugated molecule targeting furin</p>Fórmula:C37H57N13O9Pureza:Min. 95%Peso molecular:827.93 g/molPancreastatin (Dephosphorylated Porcine)
CAS:Pancreatastatin is a peptide hormone that inhibits energy metabolism. Pancreatastatin is a biologically active peptide that has been isolated from the pancreas and shown to have effects on the endocrine system, including regulation of feeding behavior. Pancreatastatin is also known as somatostatin and is found in both animals and humans. Pancreatastatin has been shown to inhibit cellular proliferation and decrease tumor size in animal models of cancer, as well as to regulate blood sugar levels in diabetic patients. Pancreatastatin is also used for treating bowel diseases such as colitis.Fórmula:C214H330N68O76SPureza:Min. 95%Peso molecular:5,103.49 g/mol[Dap3]-Ghrelin (Human, Rat, 1-5)
CAS:<p>Dap3-Ghrelin is a Ghrelin related peptide and is the active fragment of Ghrelin that binds to Ghrelin receptors with high affinity and activates the same signaling pathway as endogenous ghrelin. This product can be used in the study of obesity as Ghrelin has been shown to be a hormone that stimulates appetite and meal initiation. It could also play a role in gaining a further understanding into diabetes as Ghrelin has been found to stimulate insulin release.</p>Fórmula:C31H51N7O7Pureza:Min. 95%Peso molecular:633.79 g/molBoc-Glu(OBzl)-OH
CAS:<p>Boc-Glu(OBzl)-OH is a peptide that inhibits the enzyme adenylate kinase. It binds to the ATP binding site on the enzyme and blocks access of the substrate, ADP, to its catalytic site. This prevents ATP from being converted into AMP, which is needed for cellular energy production. Boc-Glu(OBzl)-OH has been used in research as an inhibitor in cell biology and pharmacology studies.<br>The purified product is supplied at high purity with low endotoxin levels.</p>Fórmula:C17H23NO6Pureza:Min. 95%Peso molecular:337.37 g/molH-Gly-Tyr-Pro-Gly-Lys-Phe-NH2
CAS:This is a synthetic peptide that mimics the endogenous human epidermal growth factor (EGF) and binds to the toll-like receptor. It has been shown to stimulate physiological function in experimental models of bowel disease and cardiac disease, as well as cancer tissues. The peptide also binds to the guanine nucleotide-binding protein, polymerase chain reaction, and inflammatory bowel disease genes. In vivo studies have confirmed that this peptide enhances the production of EGF in maternal blood and stimulates squamous carcinoma growth in an animal model.Fórmula:C33H46N8O7Pureza:Min. 95%Peso molecular:666.78 g/molZ-Ile-Glu(OtBu)-Ala-Leu-H (aldehyde)
CAS:<p>inhibitor of chymotrypsin-like activity of the multicatalytic proteinase complex in HT4 cells. Causes accumulation of ubiquitinylated proteins in neuronal cells.</p>Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molBoc-Arg(NO2)-OH
CAS:<p>Boc-Arg(NO2)-OH is an activated molecule that is used as an anticoagulant. It inhibits the serine protease, which has an inhibitory effect on heparin-induced thrombocytopenia, and also inhibits platelet aggregation. Boc-Arg(NO2)-OH has been shown to have a potent inhibition of the enzyme that converts prothrombin into thrombin. This effect can be reversed by adding protamine sulfate. The clinical data suggest that this drug may be beneficial for patients with severe or life-threatening conditions who are taking heparin therapy or undergoing surgery and need anticoagulation. The prognosis of this drug is unclear, but it appears to be safe when administered in conjunction with other medications such as aspirin and warfarin.</p>Fórmula:C10H19NO4Pureza:Min. 95%Peso molecular:319.32 g/molFmoc-Glu(OtBu)-OH•H2O
CAS:Please enquire for more information about Fmoc-Glu(OtBu)-OH•H2O including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C24H27NO6•H2OPureza:Min. 98.0 Area-%Peso molecular:443.51 g/molUroguanylin (Human)
CAS:<p>Uroguanylin (Human) product containing the disulfide bonds: Cys4-Cys12 and Cys7-Cys15 and avaialable in the trifluoroacetate salt form. Uroguanylin is a peptide hormone that is involved in the regulation of fluid and electrolyte balance in the body. It is produced in the intestinal tract, specifically in the lining of the small intestine and colon.<br>Uroguanylin belongs to a family of peptides that includes guanylin and the heat-stable enterotoxins (STs).These peptides all share a similar structure and function, as they bind to and activate the guanylate cyclase-C (GC-C) receptor in intestinal cells.<br>Activation of GC-C by uroguanylin leads to an increase in cyclic GMP (cGMP) levels, which in turn activates a variety of downstream signaling pathways. This leads to an increase in chloride and bicarbonate secretion in the intestine, as well as an increase in intestinal fluid secretion. Uroguanylin also stimulates sodium and water reabsorption in the kidneys, leading to an increase in urine output.<br>Uroguanylin has been studied for its potential therapeutic applications, particularly in the treatment of gastrointestinal disorders. For example, synthetic analogs of uroguanylin are being developed as potential treatments for constipation and other disorders of intestinal motility. Additionally, uroguanylin has been shown to have anti-inflammatory properties and may be useful in the treatment of inflammatory bowel disease.</p>Fórmula:C64H102N18O26S4Pureza:Min. 95%Peso molecular:1,667.89 g/molFmoc-Ser(tBu)-Gly-OH
CAS:Fmoc-Ser(tBu)-Gly-OH is a building block for the synthesis of dipeptides. It contains a free amino group and can be used to synthesize peptides containing serine and glycine. This reagent can also be used in the synthesis of other dipeptides, such as Fmoc-Leu-OH, Fmoc-Phe-OH, and Fmoc-Ile-OH.Fórmula:C24H28N2O6Pureza:Min. 95%Peso molecular:440.49 g/molFmoc-Arg(Pbf)-OH
CAS:<p>Fmoc-Arg(Pbf)-OH is an amido-resin that is used in the industrial preparation of polyamides and as a reactive component for the synthesis of various peptide or protein drugs. The polymerisation reaction leads to the formation of a linear chain with a high molecular weight and low viscosity. Fmoc-Arg(Pbf)-OH has been used as an envisaged component for the synthesis of acetylcholine, messenger RNA, and nicotinic acetylcholine receptor. Trifluoroacetic acid is commonly used as a solvent in this process.</p>Fórmula:C34H40N4O7SPureza:Min. 98.0 Area-%Peso molecular:648.77 g/molFmoc-Asp(OtBu)-OH
CAS:Fmoc-Asp(OtBu)-OH is a chemical compound that belongs to the group of modified amino acids. The synthesis of Fmoc-Asp(OtBu)-OH starts with the reaction of nicotinic acetylcholine, sodium carbonate, and chloride in trifluoroacetic acid. The product is then reacted with a disulfide bond and modified with polymerase chain and saponified. The final modification is achieved by reacting Fmoc-Asp(OtBu)-OH with messenger RNA (mRNA), which produces the desired product. Fmoc-Asp(OtBu)-OH has been shown to have minimal activity, as it does not elute from an ion exchange column under normal conditions. It also has no effect on acetylcholine release in rat hippocampal slices or on morphology when incubated in vitro for 24 hours at 37 degrees Celsius.Fórmula:C23H25NO6Pureza:Min. 98.0 Area-%Peso molecular:411.46 g/molLixisenatide
CAS:<p>Lixisenatide is a peptide hormone that belongs to the class of dipeptidyl peptidase-4 inhibitors. It is used in the treatment of type 2 diabetes, including those with a body mass index (BMI) greater than 27 kg/m2 or who have had type 2 diabetes for more than 10 years. Lixisenatide reduces postprandial blood glucose levels by delaying gastric emptying and increasing glucagon-like peptide-1 (GLP-1) release. Lixisenatide has been shown to be effective in reducing cardiovascular events in people with congestive heart failure. Lixisenatide also has water vapor and cardiac effects that are similar to those of GLP-1 agonists.</p>Fórmula:C215H347N61O65SPureza:Min. 95%Peso molecular:4,858.6 g/molBoc-D-Ser(Bzl)-OH
CAS:Boc-D-Ser(Bzl)-OH is a synthetic molecule that can be used in peptide synthesis. It is a potent inhibitor of galactose and tetrazole, and it inhibits the activities of enzymes involved in the synthesis of proteins, such as methionine synthase. Boc-D-Ser(Bzl)-OH has been shown to inhibit atherosclerotic lesions by blocking secretagogue activity and also inhibits the production of inflammatory mediators. This compound has potent inhibitory effects on piperidine.Fórmula:C15H21NO5Pureza:Min. 95%Peso molecular:295.33 g/molEDDnp
CAS:<p>EDDnp is a potent and selective inhibitor of the proteolytic enzyme dipeptidyl peptidase IV (DPP-IV). EDDnp binds to the active site of DPP-IV, which prevents it from cleaving peptides at the carboxy terminus. The inhibition of DPP-IV results in an increase of peptide hormones such as glucagon-like peptide 1 (GLP-1) and gastric inhibitory polypeptide (GIP), which are involved in regulating blood glucose levels. In addition, there are high values of EDDnp in human serum and urine, which may be due to its function as a potential biomarker for diabetes. The physiological function of EDDnp is still being investigated.</p>Fórmula:C8H10N4O4Pureza:Min. 95%Peso molecular:226.19 g/molDnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH
CAS:The enzyme DNP-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser (DAPPLE) is a zymogen that is activated by proteolytic cleavage to form an active enzyme. DAPPLE has been shown to cause neuronal death in vitro. The enzyme can be inhibited by the addition of specific inhibitors, such as 4-(2-aminoethyl)benzenesulfonyl fluoride, which blocks the activity of matrix metalloproteinases. DAPPLE has been found in mammalian ovaries and induces the release of growth factors when it is activated by proteolytic cleavage. The optimum pH for DAPPLE activity is 7.5 and it can be inhibited by the addition of certain drugs, such as phenylmethylsulfonyl fluoride or sodium azide.Fórmula:C52H77N17O14Pureza:Min. 95%Peso molecular:1,164.3 g/molProangiotensin-12 (Rat)
CAS:<p>Proangiotensin-12 is a peptide that is used as a research tool for the study of angiotensin II and its receptor. This product is an activator of the receptor and can be used to identify antibodies against the protein. Proangiotensin-12 has been shown to inhibit ion channels, and has also been shown to bind with high affinity to the angiotensin II receptor. This product can be used in pharmacological studies on ligands or receptors.</p>Fórmula:C77H109N19O17Pureza:Min. 95%Peso molecular:1,572.8 g/molBoc-Thr(Bzl)-OH
CAS:<p>Boc-Thr(Bzl)-OH is a peptide that can be used as an activator, inhibitor and ligand. It has been shown to activate ion channels and increase the permeability of cell membranes. The high purity of this peptide allows it to be used in research tools such as antibody production, protein interactions, and receptor ligand pharmacology.</p>Fórmula:C16H23NO5Pureza:Min. 95%Peso molecular:309.36 g/molPACAP38 (Human)
CAS:<p>PACAP38 is a ligand that belongs to the family of peptides. It binds to the PAC1 receptor and activates it. PACAP38 has been shown to inhibit ion channels, such as potassium channels and calcium channels, in neuronal cells. The protein interactions of PACAP38 are not yet fully understood.</p>Fórmula:C203H331N63O53SPureza:Min. 95%Peso molecular:4,534.3 g/molFmoc-D-Arg(Pbf)-OH
CAS:<p>Fmoc-D-Arg(Pbf)-OH is a synthetic D-arginine peptide. It is an inhibitor of protein interactions, activator of ligand, and a research tool for receptor binding studies. Fmoc-D-Arg(Pbf)-OH has been used to characterize ion channels and antibody binding sites. This molecule has high purity with no impurities or traces of solvent.</p>Fórmula:C34H40N4O7SPureza:Min. 95%Peso molecular:648.78 g/molBz-Gly-Arg [Hippuryl-Arginine]
CAS:<p>Bz-Gly-Arg is a basic protein that belongs to the class of peptide hormones. It is activated by hydrolysis and has been shown to be highly active in human serum. Bz-Gly-Arg inhibits creatine kinase, which is an enzyme that breaks down ATP and creatine phosphate to produce creatinine and ADP. This inhibition leads to a decrease in ATP levels, which can lead to cell death. The kinetic properties of Bz-Gly-Arg have been studied using sephadex G-100 chromatography and found the optimum pH for this protein is neutral. The polymerase chain reaction has also been used to study the sequence of amino acids in this protein, showing it contains amide bonds as well as peptides and biochemicals.>>END>></p>Fórmula:C15H21N5O4Pureza:Min. 95%Peso molecular:335.36 g/molH-Ala-Tyr-Pro-Gly-Lys-Phe-NH2
CAS:<p>H-Ala-Tyr-Pro-Gly-Lys-Phe-NH2 is a selective inhibitor of aminopeptidase N. It has been shown to inhibit neutrophil and leukocyte recruitment in rat peritonitis models, as well as to reduce the severity of carrageenan induced paw edema in rats. H-Ala-Tyr-Pro-Gly-Lys-Phe NH2 also inhibits the activation of platelets by aspirin and reduces their aggregation, which may be due to inhibition of PAR4.<br>PAR4 is a G protein coupled receptor that is activated by proteases such as thrombin and trypsin. Activation of PAR4 induces proinflammatory cytokines, leading to increased leukocyte recruitment and inflammation.</p>Fórmula:C34H48N8O7Pureza:Min. 95%Peso molecular:680.80 g/molPramlintide
CAS:Pramlintide is a synthetic analog for amylin pancreatic peptide that has been used for the treatment of Type I and Type II Diabetes as a tool for glycemic control, stimulating glucose production and reducing appetite. This product has disulfide bonds between Cys2 and Cys7 and is available in the trifluoroacetate salt form.Fórmula:C171H267N51O53S2Pureza:Min. 95%Peso molecular:3,949.47 g/mol[Leu31, Pro34]-NPY (Porcine)
CAS:NPY is a neuropeptide that belongs to the peptide family of neuropeptides. NPY is an activator of G-protein coupled receptors, and it regulates a variety of physiological functions, such as feeding behavior, energy expenditure and water balance. NPY is also involved in various diseases, such as diabetes mellitus, hypertension and cardiac hypertrophy. NPY (Porcine) can be used as a research tool for studying the biological function of NPY or for ligand-binding assays.Fórmula:C190H286N54O56Pureza:Min. 95%Peso molecular:4,222.6 g/molUbenimex (Bestatin) HCl Salt
CAS:<p>Ubenimex is a peptide-based inhibitor of aminopeptidase enzymes that act on the N-terminus of amino acid chains. It is also an inhibitor of Leucine aminopeptidase 3 (LAP3) and a potent irreversible inhibitor of Leukotriene A4 (LTA4) hydrolase. It is used in the treatment of non-alcoholic steatohepatitis. Ubenimex binds to the active site of aminopeptidases and inhibits their activity, thus preventing degradation of peptides. Ubenimex has been shown to inhibit aminopeptidase A and B, but not C or D. As a result, it prevents cleavage of the N-terminal amino acids from proteins, which may be involved in inflammatory processes. Furthermore Bestatin has been shown to exhibit antibacterial properties against P. gingivalis and F. nucleatum and is available in the salt form: Hydrochloride.</p>Pureza:Min. 98%Peso molecular:344.84 g/molNPY (Porcine, Bovine)
CAS:<p>NPY is a peptide that belongs to the family of neuropeptides. NPY regulates appetite and energy expenditure, among other physiological processes, by binding to receptors in the brain. NPY has been shown to be an inhibitor of protein interactions, activator of ligands, and a receptor for antibodies. This peptide is synthesized in the hypothalamus as well as other parts of the central nervous system. NPY is also found in blood platelets, pancreas, and intestines.</p>Fórmula:C190H287N55O57Pureza:Min. 95%Peso molecular:4,253.6 g/molKisspeptin-10 (Human) / Metastin (Human, 45-54)
CAS:<p>Metastin is a peptide that activates the Kisspeptin receptor. It has been shown to inhibit protein interactions, activate ligands and receptors, and act as a research tool in cell biology. Metastin is an inhibitor of the G-protein coupled receptor, KISS1R. Metastin has been shown to activate the LGR5 receptor.</p>Fórmula:C63H83N17O14Pureza:Min. 95%Peso molecular:1,302.4 g/molTAPI-1
CAS:<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>Fórmula:C26H37N5O5Pureza:Min. 95%Peso molecular:499.60 g/molBoc-D-Phe-OH
CAS:<p>Boc-D-Phe-OH is an antimicrobial peptide that is a small molecule with a molecular weight of 254.8. It has been shown to have anti-tumor activity, and can be used as an alternative to conventional chemotherapeutic drugs in the treatment of cancer. Boc-D-Phe-OH binds to the hydrophobic region on the surface of cells and disrupts the cell's membrane, causing cell death by apoptosis. This peptide also shows antibacterial activity against gramicidin S, which is a Gram-positive antibiotic that belongs to the polymyxins class. The antibacterial activity of this peptide may be due to its ability to bind to divalent cations such as calcium ions and magnesium ions. Boc-D-Phe-OH has been synthesized using a method that is both efficient and rapid (less than 12 hours). It has also been shown that this peptide does not show any</p>Fórmula:C14H19NO4Pureza:Min. 95%Peso molecular:265.3 g/molAc-Leu-Glu-His-Asp-H (aldehyde)
CAS:<p>Ac-Leu-Glu-His-Asp-H (aldehyde) is a research tool that is used in the study of ion channels and receptor proteins. It can be used to activate a receptor or ligand, or to inhibit them. Ac-Leu-Glu-His-Asp-H (aldehyde) can also be used as an antibody to identify peptides and proteins. This product has high purity and is intended for use in pharmacology and life science research.</p>Fórmula:C23H34N6O9Pureza:Min. 95%Peso molecular:538.55 g/molEndothelin-1 (Human) Antiserum
Endothelin-1 (ET-1) is a peptide hormone that stimulates the release of catecholamines from the adrenal medulla, and acts as a vasoconstrictor. ET-1 is a potent activator of endothelin receptor type A (ETA), which causes vasoconstriction and bronchoconstriction. The antibody recognizes human ET-1 and does not cross react with other endothelin peptides. This antibody can be used for the detection of ET-1 in tissues or cell culture supernatants. It can also be used to purify recombinant human endothelin or ET receptor subtypes.Pureza:Min. 95%Boc-D-Glu(OBzl)-OH
CAS:<p>Boc-D-Glu(OBzl)-OH is a potent and selective activator of the D2 dopamine receptor. It binds to the D2 receptor with high affinity and specificity. Boc-D-Glu(OBzl)-OH will protect against D2 receptor desensitization and downregulation, which are common side effects that occur when the D2 receptor is overstimulated by other ligands. Boc-D-Glu(OBzl)-OH may also be useful as a pharmacological tool in studying the function of the D2 receptor in cell biology, cancer research, immunology, and neuropharmacology.</p>Fórmula:C17H23NO6Pureza:Min. 95%Peso molecular:337.37 g/molLactacystin
CAS:<p>Lactacystin is a peptide that acts as an activator of ion channels. It binds to the receptor and activates the ligand-gated ion channel, which then opens the ion channel. This leads to increased influx of ions into the cell and an increase in intracellular calcium concentration. Lactacystin has been used as a research tool for studies on protein interactions, such as antibody-antigen interactions and receptor-ligand interactions. Lactacystin is also used for pharmacological purposes, such as for pain relief or for treatment of epilepsy.</p>Fórmula:C15H24N2O7SPureza:Min. 95%Peso molecular:376.43 g/molCART (Human, 55-102)
CAS:CART is a peptide that acts as an activator for the CART receptor. It has been shown to be a ligand for the CART receptor and blocks calcium channels in cell culture. It is a potent inhibitor of ion channels, which are proteins that allow ions to pass through the membrane of cells. CART is also used as a research tool in cell biology, pharmacology, and life science.Fórmula:C225H365N65O65S7Pureza:Min. 95%Peso molecular:5,245.2 g/molBoc-Trp(CHO)-OH
CAS:<p>Boc-Trp(CHO)-OH is a peptide that is an activator of the ion channel TRPV1. It binds to the receptor for capsaicin and then causes a conformational change in the receptor protein, which leads to activation of the ion channel. Boc-Trp(CHO)-OH is used as a research tool in pharmacology, cell biology, and antibody production. This peptide can be synthesized with high purity and has been shown to have inhibitory effects on TRPV1 channels.</p>Fórmula:C17H20N2O5Pureza:Min. 95%Peso molecular:332.35 g/molTeduglutide
CAS:<p>Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.<br>One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD</p>Fórmula:C164H252N44O55SPureza:Min. 95%Peso molecular:3,752.16 g/mol(Pro-Pro-Gly)5 • 4 H2O
<p>Pro-Pro-Gly is a research tool that is used as an activator, ligand, or receptor in cell biology. Pro-Pro-Gly contains a Gly residue at the end of the peptide chain. It can be used to inhibit ion channels and can be synthesized using a high purity technique. Pro-Pro-Gly has been shown to have the ability to bind to antibodies and other proteins, which may be used for pharmacological purposes.</p>Fórmula:C60H87N15O16•4H2OPureza:Min. 95%Peso molecular:1,346.46 g/molH-Gly-Arg-Gly-Glu-Ser-OH
CAS:<p>H-Gly-Arg-Gly-Glu-Ser-OH is a monoclonal antibody that binds to the integrin receptor on the surface of fibroblasts. It has been shown to inhibit the angiogenic process in vitro, by reducing the expression of growth factors β1 and VEGF. This antibody also inhibits collagen gel contraction and membrane interactions. The detection time for this antibody is approximately 5 days.</p>Fórmula:C18H32N8O9Pureza:Min. 95%Peso molecular:504.5 g/molFmoc-Cys(Pam)2-OH
CAS:<p>Fmoc-Cys(Pam)2-OH is a building block that can be used in the synthesis of lipopeptides. It is used in the research of vaccines and has been shown to target tumor cells.</p>Fórmula:C53H83NO8SPureza:Min. 95%Peso molecular:894.32 g/molAc-Tyr-Val-Gly
CAS:<p>Ac-Tyr-Val-Gly is a mitochondrial protein that regulates mitochondrial functions and is involved in the regulation of apoptosis. Ac-Tyr-Val-Gly interacts with nuclear DNA and regulates transcription, translation, and replication. Ac-Tyr-Val-Gly has been shown to be toxic to liver cells; however, it has been shown to have no effect on neuronal death or apoptosis pathway. These effects may be due to its ability to induce proteolytic activity in neurons and its ability to activate proapoptotic proteins such as Bax.</p>Fórmula:C30H37N5O13Pureza:Min. 95%Peso molecular:675.64 g/molColivelin
CAS:<p>Colivelin is a peptide that can be found in the central nervous system. It has been shown to have a wide variety of biological activities, including being an inhibitor of neuronal death, enhancing axonal growth and proliferation, and decreasing the activity of signal pathways. Colivelin has also been shown to inhibit the proliferation of human osteosarcoma cells by binding to their cell surface receptors.</p>Fórmula:C119H206N32O35Pureza:Min. 95%
