
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29863 productos de "Péptidos"
H-LTPLQFGNLQK^-OH
Peptide H-LTPLQFGNLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Substance P (3-11)/Nona-Substance P
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C52H79N13O11SPeso molecular:1,094.35 g/molH-PQGR^IVGGK-OH
Peptide H-PQGR^IVGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LIYDSSLCDL^-OH
Peptide H-LIYDSSLCDL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALDAAYCFR^-OH
Peptide H-ALDAAYCFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSGFFVFSR^-OH
Peptide H-GSGFFVFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Asp-Glu-Asp-Glu
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C18H26N4O13Peso molecular:506.42 g/molH-NLHQPPLR^-OH
Peptide H-NLHQPPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KPVSKMRMATPLLMQAL-OH
Peptide LCBiot-KPVSKMRMATPLLMQAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH
H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C275H477N125O51Peso molecular:6,350.54 g/molH-CNTATCATQR^-OH
Peptide H-CNTATCATQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-HVPGGGSVQIVYKPVDLSKV-OH
Peptide LCBiot-HVPGGGSVQIVYKPVDLSKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTLTPEEEAR^-OH
Peptide H-VTLTPEEEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPTTAASTPDAVDK^-OH
Peptide H-VPTTAASTPDAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NYTAPGGGQFTLPGR^-OH
Peptide H-NYTAPGGGQFTLPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for the synthesis of peptides. The resin is composed of the building blocks Ile, 2-chlorotrityl chloride and N,N'-Dibenzyloxycarbonyl (DBOC). It is used in the manufacture of peptides with amines, alcohols and thiols. This resin can be used in automated peptide synthesizers to produce peptides up to 400 amino acids long.Pureza:Min. 95%H-VVVGAGDVGK^-OH
Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTEQGHELSNEER^-OH
Peptide H-AVTEQGHELSNEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LITVQVVPVAAR^-OH
Peptide H-LITVQVVPVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-DENPVVHFFKNIVTPRTPP-NH2
Peptide Biot-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALLFIPR^-OH
Peptide H-ALLFIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 10 (HETRLLQTGIHVRVS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,746 g/molH-FFFNIFTR^-OH
Peptide H-FFFNIFTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Thr-Val-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C18H27N3O5Peso molecular:365.42 g/mol[pGlu3]-Amyloid-β Protein (3-42) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:4,309.9 g/molBiot-KRRRALSVASLPGL-OH
Peptide Biot-KRRRALSVASLPGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ser-Gly-Ser-Glu-Ala-Tyr-Gln-Gly-Val-Gln-Gln-Lys-Tr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C71H104N20O26Peso molecular:1,653.7 g/molCMVpp65 - 82 (QIFLEVQAIRETVEL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788.1 g/molH-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GnRH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C55H76N16O15Peso molecular:1,200.57 g/molSex pheromone, iCF10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C40H67N7O9Peso molecular:790 g/molH-GLDKDY-NH2
Peptide H-GLDKDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SLKLMATLFSTYAS-OH
Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELTR-NH2
Peptide H-ELTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PKA Substrate, Catalytic Subunit
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,016.1 g/molHBV HBsAg 190-197 (H-2 Kb)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Biot-KKALRRQETVDAL-OH
Peptide Biot-KKALRRQETVDAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 48
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,644 g/molH-ADDGRPFPQVIK^-OH
Peptide H-ADDGRPFPQVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 50
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,715 g/molH-DRV^YIHPF-OH
Peptide H-DRV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQAPNLVYMVTGNPASDEIK^-OH
Peptide H-EQAPNLVYMVTGNPASDEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IALGGLLFP^ASNL^R^-OH
Peptide H-IALGGLLFP^ASNL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IAIDLFK^-OH
Peptide H-IAIDLFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNDTTLQVLNTWYTK^-OH
Peptide H-LNDTTLQVLNTWYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DRLPKSDSEDGPRALNQLSC-NH2
Peptide Ac-DRLPKSDSEDGPRALNQLSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-FHDDSDEDLLHI-NH2
Peptide Ac-FHDDSDEDLLHI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RPPGFS^P-OH
Peptide H-RPPGFS^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGK^LSKIWDLPLDE-OH
Peptide H-MGK^LSKIWDLPLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASSIIDELFQDR^-OH
Peptide H-ASSIIDELFQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
