
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29863 productos de "Péptidos"
HIV - 1 MN ENV - 131
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,310.5 g/molSIVmac239 - 28
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,636.9 g/molBiot-DENPVVHFFKNIVTPRTPP-NH2
Peptide Biot-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STAGNFLVNPLEPK^-OH
Peptide H-STAGNFLVNPLEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VEHWGL^DQPL^LK-OH
Peptide H-VEHWGL^DQPL^LK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for the synthesis of peptides. The resin is composed of the building blocks Ile, 2-chlorotrityl chloride and N,N'-Dibenzyloxycarbonyl (DBOC). It is used in the manufacture of peptides with amines, alcohols and thiols. This resin can be used in automated peptide synthesizers to produce peptides up to 400 amino acids long.Pureza:Min. 95%Ser-Gly-Ser-Glu-Ala-Tyr-Gln-Gly-Val-Gln-Gln-Lys-Tr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C71H104N20O26Peso molecular:1,653.7 g/molMammaglobin-A precursor (32-40)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-EP^QVYTLPPSR^-OH
Peptide H-EP^QVYTLPPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LITVQVVPVAAR^-OH
Peptide H-LITVQVVPVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-KRRRALSVASLPGL-OH
Peptide Biot-KRRRALSVASLPGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVVGAGDVGK^-OH
Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NYTAPGGGQFTLPGR^-OH
Peptide H-NYTAPGGGQFTLPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DRV^YIHPF-OH
Peptide H-DRV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 82 (QIFLEVQAIRETVEL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788.1 g/molH-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GnRH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C55H76N16O15Peso molecular:1,200.57 g/molBiot-RRRDDDSDDD-NH2
Peptide Biot-RRRDDDSDDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Bax-BH3
Peptide Bax-BH3 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C77H136N22O27SPeso molecular:1,834.13 g/molH-LEAFL^TQK-OH
Peptide H-LEAFL^TQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SLKLMATLFSTYAS-OH
Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NTTCVNWNQY-NH2
Peptide H-NTTCVNWNQY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLAVTDSPAR^-OH
Peptide H-VLAVTDSPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Adrenomedullin 2 (Human, 1-7) Antiserum
Adrenomedullin 2 (Human, 1-7) Antiserum is a research tool that is an antibody. This antibody is used to detect the presence of adrenomedullin 2 in human serum and tissue. It has been shown to inhibit ion channels, activate receptors, and bind to cell surface proteins. This antibody can also be used as a ligand for receptor binding studies or in assays for protein interactions.Pureza:Min. 95%H-YGGFL^RRI-OH
Peptide H-YGGFL^RRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 29 (VYALPLKMLNIPSIN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,686.1 g/molSIVmac239 - 50
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,715 g/molH-NLHQPPLR^-OH
Peptide H-NLHQPPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLVTGLWGK^-OH
Peptide H-SLVTGLWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DYVSQFEGSALGK^^^-OH
Peptide H-DYVSQFEGSALGK^^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSVFVPPR^-OH
Peptide H-VSVFVPPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGIVDEGALLR^-OH
Peptide H-GGIVDEGALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLPSSIEK^-OH
Peptide H-GLPSSIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Gelsolin
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-EAEDL^QVGQVELGGGPGAGSLQPLALEGSLQ-OH
Peptide H-EAEDL^QVGQVELGGGPGAGSLQPLALEGSLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELTR-NH2
Peptide H-ELTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPIEDGSGEVVLSR^-OH
Peptide H-IPIEDGSGEVVLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLQVNSL^QTV-OH
Peptide H-DLQVNSL^QTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESTLHLVLRLRGG-hydrazide
Peptide H-ESTLHLVLRLRGG-hydrazide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Z-GLF-CMK
Peptide Z-GLF-CMK is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQAEPDNLAR^-OH
Peptide H-IQAEPDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 48
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,644 g/molHBV HBsAg 190-197 (H-2 Kb)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-TTPPV^LDSDGSFFLYSK^-OH
Peptide H-TTPPV^LDSDGSFFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVGVEPAADGK^-OH
Peptide H-TVGVEPAADGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RPPGFS^P-OH
Peptide H-RPPGFS^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTSANIQEFAGCK^-OH
Peptide H-AVTSANIQEFAGCK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 70
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,718 g/molH-IAIDLFK^-OH
Peptide H-IAIDLFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITQVLHFTK^-OH
Peptide H-ITQVLHFTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
