
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29635 productos de "Péptidos"
Ac-Lys-Thr-Lys-Gln-Leu-Arg-AMC
Ac-Lys-Thr-Lys-Gln-Leu-Arg-AMC is a peptide that is used as a research tool in the study of protein interactions. Ac-Lys-Thr-Lys-Gln-Leu-Arg-AMC binds to the acetylcholine receptor (AChR) at the interface between two subunits, which inhibits the formation of ion channels and blocks neurotransmission. This peptide has been shown to be a potent inhibitor of AChR activation by nicotinic agonists, such as acetylcholine (ACh), nicotine, and carbachol. Acetylcholine binding to AChRs induces conformational changes in the receptor that are transmitted across the synapse to activate postsynaptic receptors on muscle cells. Acetylcholine binding triggers an allosteric change in the AChR that results in increased permeability of ion channels, leading to depolarization of
Fórmula:C45H73N13O11Pureza:Min. 95%Peso molecular:972.14 g/molL-Methionylglycyl-L-methionyl-L-methionine trifluoroacetate
CAS:L-Methionylglycyl-L-methionyl-L-methionine trifluoroacetate is a medicinal compound that has shown promise as an anticancer agent. It is an analog of a naturally occurring tripeptide found in human urine and has been shown to inhibit the activity of certain kinases, which are enzymes that play a key role in cancer cell growth and survival. L-Methionylglycyl-L-methionyl-L-methionine trifluoroacetate induces apoptosis, or programmed cell death, in cancer cells by inhibiting the activity of these kinases. This inhibitor has demonstrated potent anticancer activity against various human tumor types, including breast and lung cancer. The compound shows favorable pharmacokinetic properties and good tolerability in preclinical studies, making it a promising candidate for further development as an anticancer therapy.Fórmula:C17H32N4O5S3•(C2HF3O2)xPureza:Min. 95%Plectasin
A synthetic antimicrobial peptide whose sequence is derived from the Fungus, Pseudoplectania nigrella. This product has disulfide bonds between Cys4-Cys30, Cys15-Cys37, and Cys19-Cys39 and is available as a hydrochloride salt and as a 0.1mg vial. One letter code: GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCYFórmula:C189H267N53O56S7Pureza:Min. 95%Peso molecular:4,401.9 g/molHuwentoxin IV
CAS:Huwentoxin IV is a potent analgesic that has been shown to have antinociceptive properties in animals. Huwentoxin IV blocks the voltage-gated sodium channel NaV1.8 and prevents the transmission of pain signals to the brain. This drug has also been shown to inhibit the activity of voltage-gated potassium channels KV1.3 and KV1.5, which are involved in neuronal excitability, suggesting that huwentoxin IV may have other therapeutic applications. Huwentoxin IV interacts with disulfide bonds and is an effective inhibitor of voltage-gated sodium channels, but not voltage-gated potassium channels, at low concentrations (10 μM).Fórmula:C174H278N52O51S6Pureza:Min. 95%Peso molecular:4,107 g/molIgA1 Hinge Region Peptide
Please enquire for more information about IgA1 Hinge Region Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C81H128N20O28Pureza:Min. 95%Peso molecular:1,830 g/molZ-Gly-Pro-Leu
CAS:Z-Gly-Pro-Leu is a bacterial enzyme that belongs to the group of carboxypeptidases. It has an optimal pH of neutral ph, and can be found in ascidian tissue. Z-Gly-Pro-Leu is a synthetic substrate, and its sequences have been determined. Functional groups of this enzyme are carboxylic acid, hydroxyl, amine and thiol. This enzyme is used in the production of synthetic peptides and it has been shown to have a high level of activity on homogenates. It has also been shown to have an effector function in pancreatic tissue when injected subcutaneously.
Fórmula:C21H29N3O6Pureza:Min. 95%Peso molecular:419.47 g/molAmylin (Rat) Antiserum
Amylin (Rat) Antiserum is a protein that is used as an inhibitor in research. It is also a ligand for the insulin receptor and can be used to study its activity. Amylin (Rat) Antiserum binds to the extracellular domain of the receptor and blocks it from binding to insulin. This prevents the activation of downstream signalling pathways, which are responsible for glucose uptake and metabolism. Amylin (Rat) Antiserum can be used as a research tool to study ion channels due to its ability to block potassium channels. The antibody has been shown to bind with high purity with little cross-reactivity in immunoassays, making it ideal for use in laboratories.
Pureza:Min. 95%[Asu1,6]-Oxytocin
CAS:Oxytocin is a peptide hormone and neurotransmitter. It is primarily used in the brain to regulate social behavior, such as maternal behaviour, sexual arousal and romantic attachment. Oxytocin is also used for uterine contractions during childbirth and to induce labour. Oxytocin can be administered by injection or as nasal spray. It has a half-life of about two minutes in the blood stream and its effects last up to one hour. Oxytocin is a nonapeptide with the amino acid sequence: Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Arg-Gly-Leu-Met-(OH). The oxytocin receptor (OXTR) belongs to G protein coupled receptors (GPCR), which are known for their roles in cell signaling, oncogenesis, immunity, inflammation, pain sensation and endocrine regulation. The OXTR is expressed throughout the body including the uterus and vagina.Fórmula:C45H69N11O12Pureza:Min. 95%Peso molecular:956.1 g/molDes-Arg10-Kallidin
Kallidin is a peptide that has regulatory effects on tissue remodeling, inflammatory responses, and the growth of new blood vessels. It is found in a number of tissues, including extracellular matrix proteins, where it acts as a regulator. Kallidin has been shown to regulate kinins, which are hormones that are responsible for the regulation of inflammation. Kallidin also regulates collagen and fibrinogen production by stabilizing these proteins. This peptide also induces leukocyte recruitment and polymorphonuclear leukocytes (PMN) activity. Kallidin can stimulate growth factor production and may play an important role in the stabilization of matrix proteins such as fibronectin.Fórmula:C50H73N13O11•2CH3COOH•4H2OPureza:Min. 95%Peso molecular:1,224.36 g/molEPGN Human
EPGN Human is a research tool that is an activator, ligand, and receptor. It is also used in Cell Biology as an antibody and an ion channel. EPGN Human is used in pharmacology as a peptide. EPGN Human has high purity and can be used in Life Science for protein interactions or as an inhibitor.
Pureza:Min. 95%Des-Asp1-[Ile8]-Angiotensin II
CAS:Des-Asp1-[Ile8]-Angiotensin II is an artificial peptide that has been shown to activate the angiotensin receptor. It is a high purity, potent inhibitor of angiotensin II. This peptide is also suitable for research and antibody production.Fórmula:C43H68N12O9Pureza:Min. 95%Peso molecular:897.08 g/molTGF b 1 Human
TGF-β is a cytokine with two forms, TGF-β1 and TGF-β2. The tgf-beta protein is a molecule that controls cell growth, differentiation and apoptosis. It can be found in the desiccated state, which must be reconstituted before use. Reconstitution of the protein requires acetonitrile and trifluoroacetic acid. Cytokines are molecules that regulate cell behavior by acting on other cells. Chromatographic techniques are used to separate these molecules by size and charge, while growth factors are molecules that promote cell growth and differentiation. The experimentally determined molecular mass of TGF-β1 is 25 kDa.END>
Pureza:Min. 95%NHS-m-dPEG® (MW = 685)
CAS:NHS-m-dPEG® (MW = 685) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-m-dPEG® (MW = 685) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:685.75 g/molAnti NPY (Human, Rat, Mouse) Serum
This is a vivitide catalogue product. Please send your vivitide product enquiry to sales@vivitide.com for an up-to-date price and availability.Pureza:Min. 95%Amino-dPEG®12-t-boc-Hydrazide
CAS:Amino-dPEG®12-t-boc-Hydrazide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-t-boc-Hydrazide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C32H65N3O15Pureza:Min. 95%Peso molecular:731.87 g/molGRF, Human Antiserum
Rabbit serum against growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Pureza:Min. 95%Hepatitis E Virus ORF2 (452-617 a.a.) Recombinant
Hepatitis E virus (HEV) is a virus that infects the liver and causes hepatitis. Recombinant HEV ORF2 protein was produced by recombinant techniques in Escherichia coli. The recombinant HEV ORF2 protein has been shown to be immunogenic in mice, rabbits, and humans. Immunodominant epitopes were found at amino acid positions 448-456 and 468-480.Pureza:Min. 95%Maleimide activated-KLH
This product is produced via the activation of mariculture Keyhole Limpet (Megathura crenulata) Hemocyanin with a maleimide group. The activated material will readily bind free sulfhydryl groups present in solution.KLH is a highly antigenic protein with a high molecular mass (4.5 x 105 - 1.3 x 107 Daltons, in aggregates of 350 and 390 kDa subunits) that elicits a strong immune response when used to immunize animals.As many as 400 moles of Cysteine-containing peptide can bind to one mole of maleimide-activated KLH.Pureza:Min. 95%Anti Gonadotropin-Releasing Hormone-Associated Peptide (GAP) (34-56), Human Serum
GAP is a natural peptide that has been found to bind to the G protein coupled receptor (GPCR) known as gonadotropin-releasing hormone receptor (GnRH-R). This receptor is linked to ion channels and plays a role in many different biological processes, including cell division and growth. GAP can be used as a research tool for studying how cells work. It can also be used in pharmacology studies, such as determining the effect of GAP on the activity of ion channels or protein interactions.
Pureza:Min. 95%Brazzien (2-54)
Brazzien (2-54) is a peptide that binds to the extracellular domain of the human receptor for Advanced Glycation Endproducts (RAGE). This receptor plays an important role in many cellular processes, including tissue damage and inflammation. Brazzien (2-54) is a potent inhibitor of RAGE activity and has been shown to inhibit the binding of RAGE ligands to RAGE.Pureza:Min. 95%Anti GIP (1-30)-OH (Porcine) Serum
Anti GIP (1-30)-OH (Porcine) Serum is a research tool that is used as an inhibitor of protein interactions. It is a natural, high purity, and biologically active product that is used for immunoassays and other biochemical studies. This product can be used to inhibit the activation of the GIP receptor by ligands, such as peptides or antibodies. Anti GIP (1-30)-OH (Porcine) Serum binds to the ligand and prevents it from binding to the receptor.Pureza:Min. 95%Z-Asp-CH2-DCB
CAS:Z-Asp-CH2-DCB is a peptide that is an activator of cell membrane ion channels and receptor proteins. It has been shown to inhibit the interaction between ligands and receptors, thus blocking the binding of chemical signals with their corresponding cells. This chemical signal can be either neurotransmitters or hormones. Z-Asp-CH2-DCB is also a research tool for studying protein interactions and cellular processes, such as ion channel activation.Fórmula:C20H17NO7Cl2Pureza:Min. 95%Peso molecular:454.26 g/molL17E Cytosolic Delivery Peptide
CAS:Synthetic peptide toxin derivative of; M-lycotoxin from the Carolina wolf spider, Hogna carolinensis. This peptide can be used for transport into the cytoplasma and is available as a 0.5mg vial.
Fórmula:C134H220N38O31Pureza:Min. 95%Peso molecular:2,859.4 g/molFollicle Stimulating Hormone, human, recombinant
Follicle stimulating hormone (FSH) is a glycoprotein that is secreted by the anterior pituitary gland. FSH stimulates follicular growth in the ovary and regulates the production of estrogen and progesterone. FSH can be used to treat infertility in women, as well as male hypogonadism. It can also be used for assisted reproduction techniques such as in vitro fertilization, gamete intrafallopian transfer, testicular sperm extraction, and ovarian hyperstimulation. FSH is synthesized from human recombinant DNA and is chromatographically purified with a freeze-dried process. Additives may include antibiotics to prevent bacterial contamination during production or storage. FSH has been shown to act synergistically with estradiol to promote follicular growth in ovaries of immature rats.Pureza:Min. 95%H-YLQLVFGIEV-OH
MAGE-A2 protein: MAGE-A2 (157-166) is an epitope of Melanoma Antigen Gene A2 and is one of the most Cancer-Testis Antigens (CTA) overexpressed in tumors of different histological types, such as prostate cancer. Type of MAGE-A expressed in tumors cells varies according to the type of tumor. The expression of MAGE-A2 causes the proliferation of prostate cancer cells and decreases the chemosensitivity. Applications of MAGE-A2 (157-166): MAGE-A2 (157-166) is used to stimulate specific immune response, cytotoxic T cell response and to analyze the cytokine production in PBMCs by ELISPOT assay. In transgenic mouse, it has been demonstrated that MAGE-A2 (157-166) was capable of eliciting a CTL response presented by HLA-A*02:01 molecules. MAGE-A2 (157-166) has been reported to elicit CTL that could lyse tumor cell expressing both HLA-A*02:01 and MAGE-A2 by stimulation of peripheral blood mononuclear cells (PBMCs) with MAGE-A2 (157-166).H-QYIKANSKFIGITE-OH
Tetanus toxin TetTox-B (830-843) DRB1*07:01 is a short part of the tetanus toxin. Tetanus toxin is produced by Clostridium tetani and is a potent neurotoxin. Indeed, tetanus toxin arrives on bloodstream and moves to a receptor complex at the neuromuscular junction. TetTox-B (830-843) DRB1*07:01 TetTox-B (830-843) DRB1*07:01 is used to stimulate the immune response and to generate DRB1*07:01-restricted T cells specific for the tetanus toxin peptide. TetTox-B (830-843) is also a classical peptide reference for the binding affinity with DRB1*07:01 molecules.EGF Human, Pichia
EGF is a protein that belongs to the epidermal growth factor family. It has been shown to be an activator of the receptor tyrosine kinase, and binds to the extracellular domain of the receptor with high affinity. EGF is a ligand for the epidermal growth factor receptor (EGFR), and it has been shown that there are many other receptors that can bind to EGF, including insulin-like growth factor 1 receptor (IGF1R), insulin-like growth factor 2 receptor (IGF2R), platelet-derived growth factor A receptor alpha chain (PDGFRα), c-met proto-oncogene, fibroblast growth factor receptor 3 (FGFR3), and nerve growth factor receptor (NGFR). EGF also activates ion channels such as TRPC6 and TRPV4, which are involved in cell proliferation and differentiation.
Pureza:Min. 95%H-WYIWLGFIAGLIAIV-OH
Peptide H-WYIWLGFIAGLIAIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C91H129N17O16Peso molecular:1,735.12 g/molSubstance P (Human, Bovine, Rat, Mouse)
CAS:Substance P is a member of the tachykinin neuropeptide family which is produced in the central nervous system (CNS) and acts through its specific receptor neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is involved in: pain perceptions as a neurotransmitter; gut motility; increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.Fórmula:C63H98N18O13S•3CH3COOH•5H2OPureza:Min. 95%Peso molecular:1,617.84 g/molH-MDYKDHDGDYKDHDIDYKDDDDK-OH
3x DYKDDDDK peptide, also called 3x FLAG peptide, is a 23 aa length peptide used for the competitive elution of DYKDDDDK-tag fusion proteins (with excess of free 3x DYKDDDDK peptide) under non-denaturing conditions, especially when a DYKDDDDK-tagged protein is sensitive to low pH.
Urocortin (Rat)
CAS:Urocortin is a peptide that is also known as corticotropin-releasing factor (CRF). It is an inhibitor of the protein phosphatase 1 and protein phosphatase 2A, which are enzymes that regulate the activity of other proteins. Urocortin also has the ability to bind to receptors for glucocorticoid hormones, such as GRP and MR, in a manner that activates them. This peptide is used in research studies to study ion channels, neuronal excitability, and other aspects of cell biology. Urocortin has been shown to be a high purity reagent with no detectable impurities.Fórmula:C206H338N62O64Pureza:Min. 95%Peso molecular:4,707.3 g/molPolystyrene AM NH2 (particle size: 250 - 315 µm capacity: 0.8 - 1.2 mmol/g)
Please enquire for more information about Polystyrene AM NH2 (particle size: 250 - 315 µm capacity: 0.8 - 1.2 mmol/g) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%Alpha-Conotoxin SI
CAS:Sourced from the marine snail, conus striatus, this synthetic cone snail toxin is a nicotinic acetylcholine receptor blocker. This product has disulfide bonds between Cys2-Cys7 and Cys3-Cys7.
Fórmula:C55H84N16O16S4Pureza:Min. 95%Peso molecular:1,353.6 g/mol[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide)
CAS:[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide) is a product sourced from bovine, is available as a 0.5mg vial and is related to the peptide hormone Parathyroid Hormone (PTH). During abnormal serum calcium levels PTH is secreted from the parathyroid gland, thus regulating calcium and phosphate levels in the body. PTH binds to its PTH receptor which is a G-protein coupled receptor that activated adenylate cyclase or phospholipase C to activate pathways involved in the mediation of bone resorption and bone formation.
Fórmula:C156H244N48O40S2Pureza:Min. 95%Peso molecular:3,496 g/molNucleolin, human, recombinant
Nucleolin is a protein that belongs to the nucleolar family of ribonucleoprotein. It has been shown to be involved in the transcription, maturation, and fibrillar assembly of ribosomal RNA. Nucleolin also plays an important role in the synthesis of other proteins by serving as a scaffold for the assembly of pre-ribosomal particles. The c-terminal domain contains a phosphoprotein called PNPase that catalyzes the hydrolysis of inositol polyphosphates. In addition, nucleolin is glycosylated during its maturation process.Pureza:Min. 95%TentaGel® XV RAM
TentaGel® XV RAM is a particle-based reagent for peptide synthesis. It contains the building blocks for peptides and has been designed to be used in conjunction with a TentaGel® XV reactor. This product is designed to increase the yield of peptides via the use of a patented process that eliminates the need for purification and can reduce reaction time by up to 50%.
Pureza:Min. 95%Lipid A (Salmonella)
CAS:Lipid A is a bacterial endotoxin that activates macrophages and dendritic cells, which in turn activate T-cells. It is a ligand for the CD14 receptor, which is a pattern recognition molecule found on macrophages and dendritic cells. Lipid A also binds to the Toll-like receptor 4 (TLR4) on host cells, initiating an inflammatory response. Lipid A has been used as a research tool to study cell biology related to activation of macrophages and dendritic cells leading to cytokine production. This activator has also been used as a ligand in antibody studies, ion channel studies, protein interactions, pharmacology experiments with peptides, and life science research.Fórmula:C110H208N2O26P2Pureza:Min. 95%Peso molecular:2,036.8 g/molMyelin Oligodendrocyte Glycoprotein
Myelin Oligodendrocyte Glycoprotein (MOG) is a glycoprotein that is expressed by oligodendrocytes and is essential for the myelinization of axons in the central nervous system. MOG has been associated with the development of multiple sclerosis and demyelinating diseases. Freeze-dried MOG is reconstituted with water before use, which may be beneficial for patients who cannot swallow pills or capsules. The reconstituted protein can be injected intravenously as an allograft. Myelin Oligodendrocyte Glycoprotein can also be used long-term after desiccating to prevent its degradation and loss of biological activity. The expansion of the chromosome carrying the gene for MOG has been shown to be associated with multiple sclerosis and other neurologic diseases.Pureza:>98.0% By Rp-HplcTNF a Mouse
TNF-α is a cytokine that is produced by many cells, including macrophages, T cells, mast cells, and synovial cells. It is a pleiotropic proinflammatory cytokine that has been implicated in cancer and other inflammatory diseases. TNF-α is a potent inducer of cell death through activation of the Fas-FasL death pathway or induction of apoptosis. In addition to its role as an anti-tumor agent, TNF-α has been shown to be important in the regulation of immune responses and inflammation. It also plays an important role in bacterial sepsis by suppressing the production of proinflammatory cytokines such as IL-1β and IL-12 by macrophages.Pureza:Min. 95%monobiotin INSL5
Monobiotin INSL5 is a peptide that is biologically active and is obtained from the New England Peptide Company. Monobiotin INSL5 has shown to be an antagonist of the insulin-like growth factor II receptor and may have potential as a therapeutic agent for diabetes mellitus.Pureza:Min. 95%Anti Nociceptin / Orphanin FQ (Human, Rat) Serum
Anti Nociceptin / Orphanin FQ (Human, Rat) Serum is a peptide that belongs to the family of orphanin FQ peptides. It has been shown to activate ion channels and ligand-gated channels. Anti Nociceptin / Orphanin FQ (Human, Rat) Serum is a high purity, pharmacology research tool for use in cell biology and receptor studies.
Pureza:Min. 95%Fmoc-N-Amido-dPEG®6-Acid
CAS:Fmoc-N-Amido-dPEG®6-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®6-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:575.65 g/molα Synuclein, human, recombinant
α-Synuclein is a protein that is encoded by the SNCA gene, and is one of the main components of Lewy bodies, which are found in neurons in people with Parkinson's Disease. α-Synuclein has been shown to protect cells from stress and prevent their death. It also acts as a chaperone for other proteins, regulating their activity. This protein has been shown to be able to bind to GTPase activators and inhibit them from activating GTPases. The molecular weight of α-synuclein is 25 kDa and it has a pI value of 4.5. It has an acidic C-terminus and its shift on gel electrophoresis is 11.5 kDaPureza:Min. 95%Anti Humanin Serum
Anti Humanin Serum is a research tool that can be used as a pharmacological reagent or as a research tool. It is an antibody that can be used to study protein interactions, such as receptor-ligand binding, and the effects of peptides on ion channels. This product is composed of high purity humanin antibodies with no detectable cross-reactivity with other proteins.Pureza:Min. 95%AGT, SERPINA8 MS Calibrator-7 (25nmol)
High quality, quantitated heavy/light peptide calibrator for angiotensinogen in Mass Spectroscopy researchPureza:Min. 95%Neurotensin (Human, Bovine, Canine)
Neurotensin is a neuropeptide that is involved in the regulation of a variety of physiological functions, including neurotransmission, cardiovascular function, and appetite. It is composed of 13 amino acids and is primarily produced in the gastrointestinal tract and the central nervous system. Neurotensin acts as a neurotransmitter and neuromodulator in the brain, where it is synthesized by neurons in several regions, including the hypothalamus, amygdala, and nucleus accumbens. In addition to its role in neurotransmission, neurotensin has been shown to be involved in the regulation of food intake and energy metabolism. It is thought to promote satiety and reduce food intake by interacting with the hypothalamus and other brain regions involved in appetite regulation. Neurotensin has also been studied for its potential therapeutic applications as it has been shown to be associated with the pathophysiology of conditions such as Parkinson's disease, pain, schizophrenia, cancer and inflammatory bowel disease.Fórmula:C78H121N21O20•2CH3COOH•6H2OPureza:Min. 95%Peso molecular:1,901.1 g/molAnti TNF-Alpha (Rat) Monoclonal Antibody
Anti TNF-Alpha (Rat) Monoclonal Antibody is a recombinant rat monoclonal antibody that binds to the TNF-α. It inhibits the effects of TNF-α and has been shown to protect against acute renal failure in rats. Anti TNF-Alpha (Rat) Monoclonal Antibody is a research tool for studying the function of TNF-α, and is used in pharmacological studies as an inhibitor of the enzyme protein kinase C. This antibody can be used for purification of proteins from cell culture or tissue samples.Pureza:Min. 95%HIV-1 p24 Recombinant, His Tag
The HIV-1 p24 Recombinant, His Tag (abbreviated as HIV-1 HRP) is a recombinant protein that is purified from the culture supernatant of transfected HEK293 cells. It has been immobilized on a His-tagged protein A column for purification. The recombinant protein has been proven to be an effective inhibitor of the human immunodeficiency virus type 1 (HIV-1). HRP binds to the CD4 receptor, which is a major component of the cellular membrane. This binding causes conformational changes in the HRP and initiates signal transduction pathways in the cell, leading to an antiviral state.Pureza:Min. 95%[D-Ala2,Met5]-Enkephalin
CAS:[D-Ala2,Met5]-Enkephalin is an inhibitory neurotransmitter that binds to receptors in the brain and spinal cord. It affects physiological functions such as locomotion, pain sensation, and blood pressure. Enkephalins are analogs of the natural neurotransmitter enkephalin that are synthesized by enzymatic cleavage of the latter from a larger precursor molecule called proenkephalin. [D-Ala2,Met5]-Enkephalin has been shown to be an effective antinociceptive agent when administered intraperitoneally or intravenously in rats. It also acts as a pressor agent and produces dextran sulfate-induced nociception in mice. The pharmacological properties of enkephalins have been shown using various analytical methods including acid analysis.Fórmula:C28H37N5O7S•CH3COOH•H2OPureza:Min. 95%Peso molecular:665.76 g/mol
