Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 29773 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Fórmula:C26H51N3O5Pureza:98%Forma y color:SolidPeso molecular:485.7PYX 1
CAS:PYX 1 is an effective orexigenic peptide.Fórmula:C70H105Cl2N19O16Pureza:98%Forma y color:SolidPeso molecular:1539.61ω-Conotoxin CVIA
CAS:ω-Conotoxin CVIA, a 27-amino acid neuropeptide, functions as a blocker of voltage-sensitive calcium channels (VSCCs) [1].Fórmula:C97H161N39O36S6Pureza:98%Forma y color:SolidPeso molecular:2641.95Competence-Stimulating Peptide-12261
CAS:Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.Fórmula:C100H149N31O23Pureza:98%Forma y color:SolidPeso molecular:2153.45Preprosomatostatin (25-34)
CAS:Preprosomatostatin (25-34) is a peptide.Fórmula:C52H83N17O15Pureza:98%Forma y color:SolidPeso molecular:1186.32C5a Anaphylatoxin (human)
CAS:C5a Anaphylatoxin (human) is a pro-inflammatory peptide that functions as a leukocyte chemoattractant, utilized in researching inflammation and immune responses
Fórmula:C350H578N108O107S8Pureza:98%Forma y color:SolidPeso molecular:8267.51Leucokinin VIII
Leucokinin VIII is an diuretic octapeptide isolated form head extracts of the cockroach.Fórmula:C42H52N10O11Pureza:98%Forma y color:SolidPeso molecular:872.92Sperm-activating peptide 1
CAS:Sperm-activating peptide 1 is a bioactive chemical.Fórmula:C44H71N11O12S2Pureza:98%Forma y color:SolidPeso molecular:1010.23M-2420
CAS:M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).Fórmula:C70H91N15O27Pureza:98%Forma y color:SolidPeso molecular:1574.56CGRP(83-119), rat
Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.Fórmula:C162H262N50O52S2Pureza:98%Forma y color:SolidPeso molecular:3806.3FOR-MET-PHE-OH acetate
FOR-MET-PHE-OH acetate increases significantly granulocyte adhesiveness when used at a concentration chemotactically effective.Fórmula:C17H24N2O6SPureza:99.81%Forma y color:SolidPeso molecular:384.45H-Ala-Ala-Tyr-OH (TFA) (67131-52-6 free base)
H-Ala-Ala-Tyr-OH TFA can be synthesized mutant peptides.Fórmula:C17H22F3N3O7Pureza:98%Forma y color:SolidPeso molecular:437.37MMK 1 acetate
MMK 1 acetate is an agonist of formyl peptide receptor 2 (FPR2), which was previously known as formyl peptide receptor-like 1 (FPRL1) [1].
Fórmula:C77H127N19O20SPureza:99.11%Forma y color:SolidPeso molecular:1671.01Dynorphin A (1-10) TFA(79994-24-4,free)
Dynorphin A (1-10) (TFA), an endogenous opioid neuropeptide, binds in the transmembrane domain of the κ-receptor.Fórmula:C59H92F3N19O14Pureza:98%Forma y color:SolidPeso molecular:1348.48Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Pureza:98%Forma y color:SolidPeso molecular:3692.15Decabassianolide
CAS:Decabassianolide is a biochemical.Fórmula:C60H105N5O15Pureza:98%Forma y color:SolidPeso molecular:1136.52Asp-Asp-Asp-Asp-Asp
CAS:Asp-Asp-Asp-Asp-Asp is a peptide consists of 5 Asp.Fórmula:C20H27N5O16Pureza:98%Forma y color:SolidPeso molecular:593.45Knqdk peptide
CAS:Knqdk peptide is a synthetic pentapeptide, located in residues 112-116 of bovine K-casein.Fórmula:C25H45N9O10Pureza:98%Forma y color:SolidPeso molecular:631.68Lactoferrin (17-41) TFA (146897-68-9 free base)
Lactoferricin B (amino acids 17-41 of lactoferrin) enhances anti-fungal agents against Candida Albicans.Fórmula:C143H225F3N46O31S3Pureza:98%Forma y color:SolidPeso molecular:3237.79Acetyl tetrapeptide-9
CAS:Acetyl tetrapeptide-9 is important for the stimulation of basement membrane polysaccharide (lumican) and the synthesis of collagen I.Fórmula:C22H33N7O9Pureza:98%Forma y color:SolidPeso molecular:539.54Solnatide
CAS:Solnatide is a synthetic peptide mimicking the lectin-like domain of TNF.Fórmula:C82H119N23O27S2Pureza:98%Forma y color:SolidPeso molecular:1923.09Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa
CAS:FMRF is a 4-residue neuropeptide from Helix aspersa snail muscles.Fórmula:C44H61N11O10Pureza:98%Forma y color:SolidPeso molecular:904.02Uty HY Peptide (246-254)
CAS:Uty HY Peptide (246-254) is a male-specific antigen from Y chromosome H-YDB gene.Fórmula:C53H77N15O13S2Pureza:98%Forma y color:SolidPeso molecular:1196.4Z-VRPR-FMK trifluoroacetate salt
Irreversible MALT1 inhibitor; dose-dependent T cell activation block and Bcl-10 cleavage reduction; decreases Jurkat cell-fibronectin adhesion; cell-permeable.Fórmula:C31H49FN10O6·CF3CO2HPureza:98%Forma y color:SolidPeso molecular:790.81Angiogenin (108-122) TFA (112173-49-6 free base)
Angiogenin (108-122) TFA, a therapeutic peptide for various diseases, including cancer and heart conditions.Fórmula:C80H126F3N25O25Pureza:98%Forma y color:SolidPeso molecular:1895QL9
CAS:QL9 is derived from the enzyme 2-oxoglutarate dehydrogenase and belongs to the endogenous peptide repertoire of all H-2d APCs.Fórmula:C52H74N10O14Pureza:98%Forma y color:SolidPeso molecular:1063.21N-Formyl-Met-Ala-Ser
CAS:N-Formyl-Met-Ala-Ser, a peptide, activates neutrophils via formyl peptide receptors.Fórmula:C12H21N3O6SPureza:98%Forma y color:SolidPeso molecular:335.38Small cardioactive peptide A
CAS:Small cardioactive peptide A modulates neuromuscular connections and feeding behavior in molluscs as a cotransmitter.Fórmula:C59H92N18O12SPureza:98%Forma y color:SolidPeso molecular:1277.54Calcitonin, eel TFA (57014-02-5 free base)
Calcitonin,eel TFA is a thyroid hormone polypeptide that can regulate calcium homeostasis and is widely used in the study of postmenopausal osteoporosis.Fórmula:C148H242F3N43O49S2Pureza:98%Forma y color:SolidPeso molecular:3528.89α-Casein (90-95)
CAS:α-Casein (90-95) is a peptide fragment of α-Casein.Fórmula:C38H57N9O9Pureza:98%Forma y color:SolidPeso molecular:783.91GRGDSPC
CAS:GRGDSPC: 7-AA thiolated peptide; non-viral gene vector; easy synthesis; high efficiency; low toxicity.Fórmula:C25H42N10O11SPureza:98%Forma y color:SolidPeso molecular:690.73Jingzhaotoxin-XII
Jingzhaotoxin-XII (JzTx-XII) functions as a potent inhibitor of the Kv4.1 channel, exhibiting an inhibitory concentration (IC50) of 0.363 μM.Fórmula:C161H227N41O44S7Pureza:98%Forma y color:SolidPeso molecular:3665.23Ceratotoxin-1
Ceratotoxin-1 (CcoTx1) is a peptide toxin that functions as an inhibitor of various voltage-gated sodium channel subtypes.Fórmula:C172H256N52O50S6Pureza:98%Forma y color:SolidPeso molecular:4044.58κM-Conotoxin RIIIJ
κM-Conotoxin RIIIJ (κM-RIIIJ) selectively inhibits Kv1.2 channels, exhibiting an IC50 value of 33 nM [1].Fórmula:C117H184N32O36S6Pureza:98%Forma y color:SolidPeso molecular:2807.3Myoregulin TFA
Myoregulin (MLN peptide) TFA, belonging to the regulin family, is a regulator of muscle performance through modulation of intracellular calcium dynamics.Fórmula:C239H391N53O67S3·xC2HF3O2Pureza:98%Forma y color:SolidPeso molecular:5175.17 (free base)Tamapin TFA
Tamapin TFA, a venom peptide isolated from the Indian red scorpion (Mesobuthus tamulus) [1], selectively targets and blocks small conductance Ca(2+)-activated K
Fórmula:C146H238N44O41S6·xC2HF3O2Pureza:98%Forma y color:SolidPeso molecular:3458.11 (free base)GpTx-1
CAS:GpTx-1 exhibits potent selectivity as a NaV1.7 antagonist, demonstrating an inhibition concentration (IC50) of 10 nM [1].Fórmula:C176H271N53O45S7Pureza:98%Forma y color:SolidPeso molecular:4073.82Margatoxin TFA
Margatoxin TFA, an alpha-KTx scorpion toxin isolated from Centruroides margaritatus venom, is a 39-amino-acid peptide that serves as a high-affinity inhibitorFórmula:C178H286N52O50S7·xC2HF3O2Pureza:98%Forma y color:SolidPeso molecular:4178.95 (free base)GrTx1
GrTx1, a peptide toxin derived from Grammostola rosea spider venom, selectively inhibits sodium channels Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, and Nav1.7,Fórmula:C159H243N45O41S8Pureza:98%Forma y color:SolidPeso molecular:3697.43κM-Conotoxin RIIIK
CAS:κM-Conotoxin RIIIK is a potassium channel antagonist that inhibits voltage-activated potassium ion channels [1].Fórmula:C106H178N34O33S6Pureza:98%Forma y color:SolidPeso molecular:2649.15Apamin TFA (24345-16-2 free base)
Apamin TFA: bee venom toxin; blocks Ca2+-activated K+ channels (SK, KCa2), strongest on SK2.Fórmula:C81H132F3N31O26S4Pureza:98%Forma y color:SolidPeso molecular:2141.36BDS-II
BDS-II, a peptide toxin comprising 43 amino acids, selectively inhibits the Kv3.4 channel [1].Fórmula:C214H301N57O57S6Pureza:98%Forma y color:SolidPeso molecular:4776.42Orexin B, human TFA (205640-91-1 free base)
Orexin B, human (TFA) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2.
Fórmula:C123H212N44O35S·C2HF3O2Pureza:98%Forma y color:SolidPeso molecular:3013.36RYTVELA TFA
CAS:RYTVELA TFA is a variant interleukin-1 receptor inhibitor with anti-inflammatory activity for the prevention of preterm labor and fetal protection.Fórmula:C38H62N10O12Forma y color:SolidPeso molecular:850.96Nuclear pore complex protein Nup98 315-360
Nuclear pore complex protein Nup98 (315-360) is the 315-360 fragment part of the nuclear pore complex (NPC) protein.
Fórmula:C190H288N50O64SPureza:98%Forma y color:SolidPeso molecular:4328.682: PN: US20040072744 SEQID: 2 claimed protein
CAS:2: PN: US20040072744 SEQID: 2 claimed protein is a synthetic peptide, used for the research of Down' syndrome and schizophrenia.
Fórmula:C43H67N13O17SPureza:98%Forma y color:SolidPeso molecular:1070.13Transportan
CAS:Transportan: 27 amino acids with galanin's N-terminus and mastoparan's C-terminus, linked by lysine.Fórmula:C134H227N35O32Pureza:98%Forma y color:SolidPeso molecular:2840.45PEN(mouse)
CAS:Endogenous peptide GPR83 agonist. ProSAAS-derived neuropeptide. Activates phospholipase C (PLC)-mediated signaling cascade in mouse hypothalamus.Fórmula:C102H169N27O34Pureza:98%Forma y color:SolidPeso molecular:2317.62p2Ca
CAS:p2Ca, peptide from alpha-ketoglutarate dehydrogenase, pairs with MHC-I protein Ld, recognized by CTL clone 2C.Fórmula:C47H66N8O12Pureza:98%Forma y color:SolidPeso molecular:935.07BQ-3020 TFA (143113-45-5 free base)
BQ-3020 (TFA) is a selective ETB agonist with a 0.2nm IC50, blocking [125I] ET-1 in the cerebellum and causing vasoconstriction.Fórmula:C98H141F3N20O27SPureza:98%Forma y color:SolidPeso molecular:2120.35
