Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29634 productos de "Péptidos"
Fmoc-PFAV
Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 46 (YYTSAFVFPTKDVAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,722 g/molAc-CISQAIPKKKKVLE-OH
Peptide Ac-CISQAIPKKKKVLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YNGIITDTIK^-OH
Peptide H-YNGIITDTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVSEDFLQDVSASTK^-OH
Peptide H-VVSEDFLQDVSASTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FNLAGNHEQEFLR^-OH
Peptide H-FNLAGNHEQEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGFEDGSVLK^-OH
Peptide H-LGFEDGSVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Suc-LLVY-[Rh110]-[D-Pro]
Fluorogenic substrate peptide of the 20S proteasome. In its intact state this peptide is non-fluorescent, however when Rhodamine fluorophore is released upon hydrolysation, fluorescence can be detected. This peptide is therefore a useful tool for analysing the activity of the 20S proteasome as well as other chymotrypsin-like proteases and calpains. This peptide is also a substrate for chymase, papain, carboxypeptidase Y, proteinase yscE (kexin) and ingensin.The presence of the D-proline residue on the C terminal of the rhodamine molecule ensures one directional rhodamine cleavage which simplifies fluorescence studies. Rhodamine 110 is a laser grade fluorescent dye with excitation maxima at 496 nm and emission maxima at 522 nm.Peso molecular:1,015.5 g/molGhrelin (Human, 1-18)
Amino acids 1-18 of the 28 amino acid peptide hormone Ghrelin which has various effects on the body, including stimulating appetite, nutrient sensing and meal initiation. It has also been found to regulate insulin resistance, diabetes and obesity and asserts its functional affects through acting as an endogenous ligand for the growth hormone secretagogue receptor (GHS-R). Ghrelin is able to associate with the GHS-R due to it containing a unique N-octanoyl group which is linked to its serine 3 residue covalently. Its wider functions such as glucose homeostasis, energy homeostasis, cardio-protective effects, its role in bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases.
Fórmula:C96H157N31O30Pureza:Min. 95%Peso molecular:2,225.51 g/molH-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-DFTAAFPR^-OH
Peptide H-DFTAAFPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NEQEQPLGQWHL^S-OH
Peptide H-NEQEQPLGQWHL^S-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLAQLNPESSLFIIASK^-OH
Peptide H-TLAQLNPESSLFIIASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Le
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C90H167N15O16Peso molecular:1,715.38 g/molLCBiot-VQIVYKPVDLSKV-OH
Peptide LCBiot-VQIVYKPVDLSKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Histone H3.2 (1-44)
Histone H3.2 is a highly common variant of the core histone H3 which is found in all eukaryotes except budding yeast. H3.2 is replication-dependent and is associated with gene silencing. Histone variants can replace canonical histones in certain cells or stages of development and help regulate numerous nuclear processes including transcription, DNA repair and chromosome segregation.Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.Peso molecular:4,668.7 g/molLCBiot-TEELRVRLASHLRKLRKRLL-OH
Peptide LCBiot-TEELRVRLASHLRKLRKRLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGNEQGVSR-OH
Peptide H-IGNEQGVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C38H64N14O14Peso molecular:959.02 g/molPuma2A peptide
PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.Sapecin B
The peptide Sapecin B exhibits antimicrobial properties against gram-positive bacteria. It is originally derived from the sarcophaga peregrine embryonic cell line, NIH-Sape-4.Peso molecular:1,094.8 g/molH-VVSVLTVLHQDWLNGKEY^K-OH
Peptide H-VVSVLTVLHQDWLNGKEY^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASTIEMPQQAR^-OH
Peptide H-ASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ranatensin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C61H85N16O13SPeso molecular:1,281.5 g/molPAR-3 Agonist (Mouse)
Protease activated receptors (PARs) are a distinctive four-member family of seven transmembrane G protein-coupled receptors (GPCRs) widely expressed in inflammatory cells. PARs are cleaved by certain serine proteases to expose a tethered ligand domain, this ligand domain then binds to and activates the receptors to initiate multiple signalling cascades. These PAR-activating proteases therefore represent PAR agonists. This PAR-2 agonist peptide mimics the sequence of the 'tethered ligand' and is therefore capable of activating the receptor independently of N-terminal proteolysis.PAR-3 is required for intercellular adhesion molecule 1 (ICAM-1) expression in endothelial cells and PAR-3 cooperates with PAR-1 to mediate the effect of thrombin on cytokine production and vascular cell adhesion molecule (VCAM-) 1 expression.PAR activation has been linked to inflammation, therefore compounds that mimic or interfere with the PAR-activating processes are attractive therapeutic candidates.Peso molecular:576.3 g/molH-GFYYSLK^-OH
Peptide H-GFYYSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGRP^EWWMDYQK^-OH
Peptide H-VGRP^EWWMDYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Ile-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Ile-Wang resin is a polystyrene resin which is used in the synthesis of peptides. It has a high loading capacity, and can be cleaved with hydrofluoric acid. The Fmoc-Ile-Wang resin contains 1% DVB as an acidic scavenger to prevent the formation of side products. The resin is also available in 100-200 mesh size.Pureza:Min. 95%SIVmac239 - 86
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,562.8 g/molAc-CKLQHVYKRLAMGDNVL-OH
Peptide Ac-CKLQHVYKRLAMGDNVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RVDPVNF-OH TFA salt
Peptide H-RVDPVNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C38H57N11O10Peso molecular:845.94 g/molAc-CKATQASQEY-OH
Peptide Ac-CKATQASQEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 98
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,657.9 g/molH-LRPVAAEVYGTER^-OH
Peptide H-LRPVAAEVYGTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Palmitoyl tetrapeptide 7 trifluoroacetate
CAS:Palmitoyl tetrapeptide 7 trifluoroacetate is an anticancer agent that acts as a protein kinase inhibitor. It has been shown to inhibit the growth of cancer cells and induce apoptosis in human tumors. This peptide analog has been studied extensively for its potential use in cancer therapy due to its ability to suppress the activity of kinases, which are enzymes involved in cell signaling pathways that regulate cell growth and division. Palmitoyl tetrapeptide 7 trifluoroacetate has also been found to be effective against certain strains of influenza virus, such as H1N1, by inhibiting neuraminidase activity. This compound has been isolated from Chinese urine samples and is structurally similar to oseltamivir, a drug used to treat influenza infections.Fórmula:C34H62N8O7•C2HF3O2Pureza:Min. 95%Peso molecular:808.93 g/molSARS-CoV-2 Antigen Peptide NCAP (AFFGMSRIGMEVTPSGTW)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C89H132N22O25S2Peso molecular:1,974.37 g/molLCBiot-KFRKAFKRFF-OH
Peptide LCBiot-KFRKAFKRFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLIPAANTGESK-OH TFA salt
Peptide H-HLIPAANTGESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C53H86N16O17Peso molecular:1,237.36 g/molH-QPTESIVRF-OH
Peptide H-QPTESIVRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C48H75N13O14Peso molecular:1,076.2 g/molAc-GCRDGPQGIAGQDRCG-OH
Peptide Ac-GCRDGPQGIAGQDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Gln(Trt)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Gln(Trt)-Wang Resin (100-200 mesh) 1% DVB is a synthetic resin that is used as a solid phase in peptide synthesis. This resin has been shown to be an activator of the beta-adrenergic receptor, which can be used for research purposes. It also has high purity and ionic strength, which make it suitable for use in the study of ligand binding to receptors and ion channels. The Fmoc-Gln(Trt)-Wang Resin (100-200 mesh) 1% DVB is used in the study of cell biology and pharmacology, as well as antibody binding.
Pureza:Min. 95%Orexin A (monkey)
Orexin A is one of two closely related peptides- the orexins (also known as hypocretins). These small neuropeptides are secreted from orexin-containing neurons, located mainly in the lateral hypothalamus (LH). Orexins function via the binding and activation of two G-protein-coupled receptors (GPCRs)- orexin receptor type 1 (OX1R) and 2 (OX2R).Orexins play several vital roles in a range of physiological activities, including: circadian rhythm, feeding behaviour, energy balance, glucose metabolism, neuroendocrine functions, stress-adaptive responses and reward and addiction. Orexins have also been linked to the pathological processes of neurological diseases such as: narcolepsy- depression- ischemic stroke- drug addiction and Alzheimer's disease.This Orexin A peptide contains two disulphide bridges, one between cysteine 7 and cysteine 13, and the other between cysteine 8 and 15. Orexin-A appears to be the isoform most important for the feeding response.Peso molecular:3,813 g/molH-GMNYLEDR^-OH
Peptide H-GMNYLEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Fam-CRGDK-OH
Peptide 5Fam-CRGDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTPPV^LDSDGSFFLYSR^-OH
Peptide H-TTPPV^LDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YAR^AAARQARAKALARQLGVAA-NH2
Peptide H-YAR^AAARQARAKALARQLGVAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVPI-NH2
Peptide H-AVPI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EVALDLSQHK^-OH
Peptide H-EVALDLSQHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Fam-DRVYIHP-OH
Peptide 5Fam-DRVYIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Atorvastatin acid
CAS:Atorvastatin acid is a pharmaceutical compound belonging to the class of statins, which is a synthetic derivative of fungal metabolites. It functions as an HMG-CoA reductase inhibitor, playing a critical role in the cholesterol biosynthesis pathway. By inhibiting this key enzyme, atorvastatin acid effectively reduces the conversion of HMG-CoA to mevalonate, a precursor of cholesterol, thus lowering overall cholesterol levels in the bloodstream.Fórmula:C33H35FN2O5Pureza:Min. 98 Area-%Forma y color:White PowderPeso molecular:558.64 g/mol
![Suc-LLVY-[Rh110]-[D-Pro]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100533.webp&w=3840&q=75)
