Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Leer más
Subcategorías de "Péptidos"
Productos de "Péptidos"
H-NPATTNQTEFER^-OH
Peptide H-NPATTNQTEFER^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP40981
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-SEQLGGDVESYDK^-OH
Peptide H-SEQLGGDVESYDK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP41155
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
R-S-R
Peptide R-S-R is a Research Peptide with significant interest within the field academic and medical …
Fórmula:
C15H31N9O5
Peso molecular:
417.5 g/mol
Ref: 3D-PP44614
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
Ac-GGMEDIYFEFMGGKKK-NH2
Peptide Ac-GGMEDIYFEFMGGKKK-NH2 is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP47894
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-EAEAAIYHLQLFEELR^-OH
Peptide H-EAEAAIYHLQLFEELR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP44190
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-SADTLWGIQK^-OH
Peptide H-SADTLWGIQK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP41517
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP46065
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-MYNPTNILDVK^-OH
Peptide H-MYNPTNILDVK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP42117
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-PLILLRLLRGQFC-NH2
Peptide H-PLILLRLLRGQFC-NH2 is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP45114
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-HAKRRLIF-NH2
Peptide H-HAKRRLIF-NH2 is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP43163
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-SLDNGGYYISPR^-OH
Peptide H-SLDNGGYYISPR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP40413
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-VTVFPIGIGDR^-OH
Peptide H-VTVFPIGIGDR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP40411
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-DIEVQGFR^-OH
Peptide H-DIEVQGFR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP48965
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
pE-HWSY^GL^RP^G-NH2
Peptide pE-HWSY^GL^RP^G-NH2 is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP43844
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-LLFNK^VTLA-OH
Peptide H-LLFNK^VTLA-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49305
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
Biot-RRRVTSAARRS-NH2
Peptide Biot-RRRVTSAARRS-NH2 is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP43414
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
HXB2 gag NO-68
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:
1,692.1 g/mol
Ref: 3D-PP50007
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
HLA-B*15:01 Human pp65 KMQVIGDQY
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Ref: 3D-PP50738
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
H-FVEGLPINDFSR^-OH
Peptide H-FVEGLPINDFSR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP47372
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
Ac-TTWI-NH2
Peptide Ac-TTWI-NH2 is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP43347
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Martes 3 de Diciembre de 2024
