Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Leer más
Subcategorías de "Péptidos"
Productos de "Péptidos"
HXB2 gag NO-13
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:
1,603.8 g/mol
Ref: 3D-PP50593
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
Cys-Kemptide
CAS:309247-46-9
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:
C35H66N14O10S1
Peso molecular:
875.1 g/mol
Ref: 3D-PP50701
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
SARS-CoV-2 Antigen Peptide NCAP (ILLNKHID)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:
C44H76N12O12
Peso molecular:
965.22 g/mol
Ref: 3D-PP50628
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
Biot-MHRSDLMSAAVR-OH
Peptide Biot-MHRSDLMSAAVR-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP46732
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-ELL^ETGDNR^-OH
Peptide H-ELL^ETGDNR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP41233
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-PAFSAIR^-OH
Peptide H-PAFSAIR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP40549
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
Boc-LGR^-OH
Peptide Boc-LGR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49770
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-IL^DTAGREEY-OH
Peptide H-IL^DTAGREEY-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP40407
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH
Peptide H-SPKMVQGSGCFGR^KMDRISSSSGLGCK^VLRRH-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49312
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-SFADINLYR^-OH
Peptide H-SFADINLYR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP49233
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
Ac-AGGKAGKDSGKAKAKAVSR-OH
Peptide Ac-AGGKAGKDSGKAKAKAVSR-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP48063
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-RPPGF^SPF-OH
Peptide H-RPPGF^SPF-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP47866
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-NINNN-NHMe
Peptide H-NINNN-NHMe is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP48671
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-RP^QQPYPQPQPQY-OH
Peptide H-RP^QQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP46702
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP47702
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-SDAPIGK^-OH
Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP47385
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-FIAGL^IAIV-OH
Peptide H-FIAGL^IAIV-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP42323
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-MADDQGRGRRRPLNEDC-NH2
Peptide H-MADDQGRGRRRPLNEDC-NH2 is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP48835
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-NSSFNPAALSR^-OH
Peptide H-NSSFNPAALSR^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP41329
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
H-ASLFSFK^-OH
Peptide H-ASLFSFK^-OH is a Research Peptide with significant interest within the field academic and medical …
Ref: 3D-PP46544
| Tamaño no definido | A consultar |
Entrega estimada en Estados Unidos, el Lunes 16 de Diciembre de 2024
