
CRF (human, rat)
CAS:
Ref. 01-4011473

Información del producto
Nombre:CRF (human, rat)
Sinónimos:
- Corticorelin
Marca:Bachem
Descripción:CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.
Propiedades químicas
Peso molecular:4757.52
Fórmula:C208H344N60O63S2
Pureza:≥ 99%
Color/Forma:White