3D-ACA77783 - 222-phosphinetriyltribenzaldehyde | 50777-83-8
Lo sentimos, no se ha encontrado ningún producto con referencia 3D-ACA77783, pero quizás quiera comprobar los siguientes productos similares:
Cryptating agent 222
CAS:Cryptating agent 222 reduces distannene & creates ligands with metal ions using a potassium mirror.Fórmula:C18H36N2O6Pureza:99.91%Forma y color:Less Crystals Colourless CrystalsPeso molecular:376.49Cytokeratin 222 Pseudogene antibody
Cytokeratin 222 Pseudogene antibody was raised using the N terminal of KRT222P corresponding to a region with amino acids ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA
QX 222
CAS:QX222 is a selective nicotinic acetylcholine receptor agonist that binds to the α7 nicotinic acetylcholine receptor. It is used as a research tool in neuroscience and physiology. QX222 has been shown to stimulate membrane hyperpolarization, which leads to an increase in cardiac action potentials. This drug also has dose-dependent effects on blood pressure and heart rate, which may be due to its ability to activate fatty acid metabolism and inhibit the binding of inhibitors to cation channels.Fórmula:C13H21ClN2OPureza:Min. 95%Peso molecular:256.77 g/molJQ-1 (carboxylic acid)-NH-C2-NH-AMPRO-222
JQ-1 (carboxylic acid)-NH-C2-NH-AMPRO-222 incorporates a BRD4 ligand and a PROTAC linker, and is used in the synthesis of PROTAC BRD4 Degrader-29.
Fórmula:C43H51ClN8O3S2Forma y color:SolidPeso molecular:827.5Anti-Phospho-MAP2K1 (Ser218, 222) Antibody (3S158)
Anti-Phospho-MAP2K1 (S218, S222) Antibody (3S158) is a Rabbit antibody targeting Phospho-MAP2K1 (S218, S222). Anti-Phospho-MAP2K1 (S218, S222) Antibody (3S158) can be used in WB,ICC/IF,IHC,IP.Forma y color:LiquidPeso molecular:Theoretical: 45 kDa.PENTAERYTHRITOL TRIACRYLATE
CAS:Fórmula:C14H18O7Pureza:96%Forma y color:LiquidPeso molecular:298.2885Sodium bisulfite
CAS:Fórmula:HNaO3SPureza:≥ 98.0%Forma y color:White to off-white crystalline powderPeso molecular:104.06Acid Yellow 36 100 µg/mL in Acetonitrile
CAS:Fórmula:C18H14N3O3S·NaForma y color:Single SolutionPeso molecular:375.38Fenarimol 1000 µg/mL in Acetone
CAS:Producto controladoFórmula:C17H12Cl2N2OForma y color:Single SolutionPeso molecular:331.20Fenarimol 10 µg/mL in Cyclohexane
CAS:Producto controladoFórmula:C17H12Cl2N2OForma y color:ColourlessPeso molecular:331.20
