CymitQuimica logo

CRAMP (1-39)

Ref. 3D-CRB1000262

1mg
477,00€
500µg
349,00€
CRAMP (1-39)
Biosynth

Información del producto

Nombre:CRAMP (1-39)
Sinónimos:
  • H-ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH
Marca:Biosynth
Descripción:Cathelicidin-related anti-microbial peptide (CRAMP) is the mouse homologue of the human LL-37 anti-microbial peptide. CRAMP possesses potent anti-bacterial activity against Gram-positive and Gram-negative bacterial strains with no haemolytic activity. As well as displaying direct anti-microbial activity, CRAMP also binds to lipopolysaccharide (LPS) to neutralise its activity. CRAMP is encoded for by the Cramp gene which is highly expressed in bone marrow and up-regulated by infectious and inflammatory signals, CRAMP is secreted by cells such as neutrophils epithelial cells and macrophages. This peptide represents the mature, extended, form of CRAMP, longer than the 34 amino acid peptide originally isolated from the bone marrow of mice. CRAMP (1-39) has enhanced anti-microbial activity compared to CRAMP (6-39).
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.

Propiedades químicas

Peso molecular:4,419.27 g/mol

Consulta técnica sobre: CRAMP (1-39)

Use el carrito para solicitar presupuestos o pedidos

Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.
◻️
CYMIT QUÍMICA, S.L. como responsable del tratamiento tratará sus datos con la finalidad de dar respuesta a sus consultas o peticiones. Puede acceder, rectificar y suprimir sus datos, así como ejercer otros derechos consultando la información adicional y detallada sobre protección de datos en nuestra Política de privacidad web.
* Campos obligatorios.