CymitQuimica logo

Biotin-β Amyloid (1-42) Human

Ref. 3D-CRB1000486

100µg
386,00€
500µg
470,00€
Biotin-β Amyloid (1-42) Human
Biosynth

Información del producto

Nombre:Biotin-β Amyloid (1-42) Human
Sinónimos:
  • Biot-(Ahx)DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OHBiotin-Ahx-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-acidBiotin-Ahx-Asp-Al a-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Ly s-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Ser-Asn-Lys-Gly-Ala-Ile
Marca:Biosynth
Descripción:Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.This peptide contains a covalently attached N-Terminal biotin tag for convenient detection and purification.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.

Propiedades químicas

Pureza:Min. 95%
Color/Forma:Powder

Consulta técnica sobre: Biotin-β Amyloid (1-42) Human

Use el carrito para solicitar presupuestos o pedidos

Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.
◻️
CYMIT QUÍMICA, S.L. como responsable del tratamiento tratará sus datos con la finalidad de dar respuesta a sus consultas o peticiones. Puede acceder, rectificar y suprimir sus datos, así como ejercer otros derechos consultando la información adicional y detallada sobre protección de datos en nuestra Política de privacidad web.
* Campos obligatorios.