Histone H3.2 (1-44)

Ref. 3D-CRB1000587

Información del producto

• Nombre: Histone H3.2 (1-44)
• Sinónimos: H-ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG-OH
• Marca: Biosynth
• Descripción: Histone H3.2 is a highly common variant of the core histone H3 which is found in all eukaryotes except budding yeast. H3.2 is replication-dependent and is associated with gene silencing. Histone variants can replace canonical histones in certain cells or stages of development and help regulate numerous nuclear processes including transcription, DNA repair and chromosome segregation.Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.

Propiedades químicas

• Peso molecular: 4,668.7 g/mol