
[Cys]-Exendin 4
Ref. 3D-CRB1000606
1mg
470,00€
500µg
386,00€

Información del producto
Nombre:[Cys]-Exendin 4
Sinónimos:
- H-CHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Marca:Biosynth
Descripción:Originally identified in Gila monster lizard (Heloderma suspectum), Exendin-4 is an incretin mimetic, an analog of glucagon-like-peptide-1 (GLP-1), it stimulates insulin secretion and modulates gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 is resistant to cleavage by plasma DPP-IV unlike GLP-1. This gives it a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 increases insulin sensitivity and improves glucose tolerance and is currently used for the treatment of Type 2 diabetes mellitus in its synthetic form Exenatide.Exendin-4 also promotes the production and proliferation of β-cells leading to regeneration of the pancreas. It is a ligand to the exendin receptor and increases pancreatic acinar cell cAMP levels. However, the GLP-1 analog was found to have a toxic effect by inducing hypotension due to relaxation of the cardiac smooth muscle.This exendin-4 peptide is provided with an N-terminal cysteine residue for conjugation reactions.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.
Propiedades químicas
Peso molecular:4,287 g/mol
Consulta técnica sobre: [Cys]-Exendin 4
Use el carrito para solicitar presupuestos o pedidos
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.