CymitQuimica logo

LL-37 amide

CAS:

Ref. 3D-CRB1000864

500µg
386,00€
1mg
470,00€
LL-37 amide
Biosynth

Información del producto

Nombre:LL-37 amide
Sinónimos:
  • H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-amideH-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Gl u-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gl n-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
Marca:Biosynth
Descripción:LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.

Propiedades químicas

Peso molecular:4,493.3 g/mol
Fórmula:C205H341N61O52

Consulta técnica sobre: LL-37 amide

Use el carrito para solicitar presupuestos o pedidos

Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.
◻️
CYMIT QUÍMICA, S.L. como responsable del tratamiento tratará sus datos con la finalidad de dar respuesta a sus consultas o peticiones. Puede acceder, rectificar y suprimir sus datos, así como ejercer otros derechos consultando la información adicional y detallada sobre protección de datos en nuestra Política de privacidad web.
* Campos obligatorios.