Información del producto
Nombre:GLP-1 (1-37)
Sinónimos:
- H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OHHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-acidH-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr- Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly -Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHgp VIP
Marca:Biosynth
Descripción:Glucagon-like peptide (GLP) 1 is a post-translationally modified version of proglucagon. GLP-1 (1-37) is a naturally produced analog of GLP-1. Unlike truncated GLP-1, GLP-1 (1-37) does not alter food intake in rat models or pancreatic insulin secretion. GLP-1 (1-37) can induce insulin production in developing adult intestinal cells via upregulation of the ngn3 gene and its downstream targets. This can restore glucose homeostasis when implanted into diabetic mice. GLP-1 (1-37) may offer a future treatment for diabetes mellitus. GLP-1 (1-37) can also inhibit chemokine-induced migration of human CD4-positive lymphocytes, an early step in atherogenesis. This raises the possibility that GLP-1 (1-37) is part of a novel mechanism to modulate vascular disease.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.
Propiedades químicas
Peso molecular:4,169.54 g/mol
Consulta técnica sobre: GLP-1 (1-37)
Use el carrito para solicitar presupuestos o pedidos
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.
