CymitQuimica logo

GLP-1 (1-37)

CAS:

Ref. 3D-CRB1001037

1mg
470,00€
500µg
282,00€
GLP-1 (1-37)
Biosynth

Información del producto

Nombre:GLP-1 (1-37)
Sinónimos:
  • H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OHHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-acidH-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr- Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly -Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHgp VIP
Marca:Biosynth
Descripción:Glucagon-like peptide (GLP) 1 is a post-translationally modified version of proglucagon. GLP-1 (1-37) is a naturally produced analog of GLP-1. Unlike truncated GLP-1, GLP-1 (1-37) does not alter food intake in rat models or pancreatic insulin secretion. GLP-1 (1-37) can induce insulin production in developing adult intestinal cells via upregulation of the ngn3 gene and its downstream targets. This can restore glucose homeostasis when implanted into diabetic mice. GLP-1 (1-37) may offer a  future treatment for diabetes mellitus. GLP-1 (1-37) can also inhibit chemokine-induced migration of human CD4-positive lymphocytes, an early step in atherogenesis. This raises the possibility that GLP-1 (1-37) is part of a novel mechanism to modulate vascular disease.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.

Propiedades químicas

Peso molecular:4,169.54 g/mol

Consulta técnica sobre: GLP-1 (1-37)

Use el carrito para solicitar presupuestos o pedidos

Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.
◻️
CYMIT QUÍMICA, S.L. como responsable del tratamiento tratará sus datos con la finalidad de dar respuesta a sus consultas o peticiones. Puede acceder, rectificar y suprimir sus datos, así como ejercer otros derechos consultando la información adicional y detallada sobre protección de datos en nuestra Política de privacidad web.
* Campos obligatorios.