Información del producto
Nombre:Cecropin-B
Sinónimos:
- H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala- Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Ly s-Ala-Leu-NH2CEF20
- Cytomegalovirus
- CMV pp65 (495-503)
Marca:Biosynth
Descripción:Cecropins are a lytic peptide family, originally isolated from Hyalophora cecropia. Cecropin-B is a cationic helical peptide that can form pores, this is believed to be the reason for its such potent lytic activity. Cecropin-B has been shown to be effective against both Gram-positive and Gram-negative bacteria plus numerous cancer cell lines including multidrug-resistant types. The ability to insert into the cell membrane and lead to pore formation is attributed to the amphipathic groups present creating amphipathic regions. The effectiveness of cecropin-B on cancer cells has led to further use of the peptide as a model for potential new anticancer drugs including cyclic cationic forms.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.
Propiedades químicas
Peso molecular:3,832.3 g/mol
Color/Forma:Powder
Consulta técnica sobre: Cecropin-B
Use el carrito para solicitar presupuestos o pedidos
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.