CymitQuimica logo

TAT-GSK'364A

Ref. 3D-CRB1001425

1mg
477,00€
500µg
349,00€
TAT-GSK'364A
Biosynth

Información del producto

Nombre:TAT-GSK'364A
Sinónimos:
  • H-RKKRRQRRRAQAKVFGAGYPSLPTMTVSDWYEQHRKYG-OHRKKRRQRRRAQAKVFGAGYPSLP™TVSDWYEQHRKYG-acidH-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Ala-Gln -Ala-Lys-Val-Phe-Gly-Ala-Gly-Tyr-Pro-Ser-Leu -Pro-Thr-Met-Thr-Val-Ser-Asp-Trp-Tyr-Glu-Gln-His-Arg-Lys-Tyr-Gly-OH
Marca:Biosynth
Descripción:TAT-GSK'364A peptide is able to specifically mimic the binding sequence between Midline-1 (MID1) and the protein phosphatase 2A (PP2A) alpha4 complex and therefore can specifically outcompete MID1 from binding to alpha4-PP2Ac. TAT-GSK'364A therefore is useful in studying Alzheimer's disease (AD). AD is characterized by senile plaques, composed of amyloid-β (Aβ) peptides, derived from sequential proteolytic cleavage of the amyloid precursor protein (APP), and neurofibrillary tangles, composed of hyperphosphorylated tau protein.MID1 protein induces the translation of amyloid precursor protein (APP) mRNA via mTOR-eIF signalling and binds to PP2A to form the MID1-PP2A complex. PP2A is the main tau phosphatase and MID1 is a negative regulator of PP2A activity as it acts as an E3 ubiquitin ligase to promote the ubiquitin-dependent degradation of PP2A.GSK'364A contains 29-residue sequence from the alpha4 subunit (AQAKVFGAGYPSLPTMTVSDWYEQHRKYG) with an N-terminal sequence derived from HIV-TAT protein (RKKRRQRRR).
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.

Propiedades químicas

Peso molecular:4,607.4 g/mol

Consulta técnica sobre: TAT-GSK'364A

Use el carrito para solicitar presupuestos o pedidos

Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.
◻️
CYMIT QUÍMICA, S.L. como responsable del tratamiento tratará sus datos con la finalidad de dar respuesta a sus consultas o peticiones. Puede acceder, rectificar y suprimir sus datos, así como ejercer otros derechos consultando la información adicional y detallada sobre protección de datos en nuestra Política de privacidad web.
* Campos obligatorios.