
Glucagon (1-29)-[Lys(AF647)]
Ref. 3D-CRB1101573
100µg
386,00€
500µg
470,00€

Información del producto
Nombre:Glucagon (1-29)-[Lys(AF647)]
Sinónimos:
- H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT(K/AF647 DBCO)-NH2HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Lys(AF647 DBCO)]-amideH-His-Ser-Gln-Gly-Thr-Phe-Th r-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala- Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-[Lys(AF647 DBCO)]-NH2
Marca:Biosynth
Descripción:Glucagon (1-29)-[Lys(AF647)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.This peptide contains AF647, structural analog to Alexa Fluor® 647 which is a widely used far-red fluorescent dye.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.
Propiedades químicas
Peso molecular:4,750 g/mol
Pureza:Min. 95%
Color/Forma:Powder
Consulta técnica sobre: Glucagon (1-29)-[Lys(AF647)]
Use el carrito para solicitar presupuestos o pedidos
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.