
Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt
CAS: 93965-89-0
Ref. 3D-FA109543
1mg | 1.275,00 € | ||
2mg | 2.207,00 € | ||
100µg | 345,00 € | ||
250µg | 469,00 € | ||
500µg | 774,00 € |
Información del producto
- Ac-Tyr-D-Phe-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln- Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Ac-Y( dF)DAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Somatoliberin(human pancreatic islet),N-acetyl-2-D-phenylalanine-29-L-argininamide-30-de-L-glutamine-31-de-L-glutamine-32-deglycine-33-de-L-glutamicacid-34-de-L-serine-35-de-L-asparagine-36-de-L-glutamine-37-de-L-glutamicacid-38-de-L-arginine-39-deglycine-40-de-L-alanine-41-de-L-arginine-42-de-L-alanine-43-de-L-arginine-44-de-L-leucinamide-
- 13: PN: WO2009031916 PAGE: 7 claimed protein
Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propiedades químicas
Consulta técnica sobre: 3D-FA109543 Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.