(Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt

CAS: 1802085-97-7

Ref. 3D-FA109844

Información del producto

• Nombre: (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt
• Sinónimos: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Arg-Val-Phe -Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH H-DAEFRHDSGYEVHHQKRVFFAEDVGSNKGAIIGLMVGGVVIA-OH
• Marca: Biosynth

Descripción

Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Propiedades químicas

• Peso molecular: 4,557.07 g/mol
• Fórmula: C₂₀₃H₃₁₂N₅₈O₆₀S
• Pureza: Min. 95%