(Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt
CAS: 1802085-97-7
Ref. 3D-FA109844
1mg | 729,00 € | ||
2mg | 1.179,00 € | ||
5mg | 2.571,00 € | ||
250µg | 300,00 € | ||
500µg | 490,00 € |
Información del producto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Arg-Val-Phe -Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH H-DAEFRHDSGYEVHHQKRVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propiedades químicas
Consulta técnica sobre: 3D-FA109844 (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.