Amylin (human) trifluoroacetate salt

CAS: 122384-88-7

Ref. 3D-FA110263

Información del producto

• Nombre: Amylin (human) trifluoroacetate salt
• Sinónimos: H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser-Thr-Asn-Val-Gl y-Ser-Asn-Thr-Tyr-NH2 H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
• Marca: Biosynth

Descripción

Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.

Propiedades químicas

• Peso molecular: 3,903.28 g/mol
• Fórmula: C₁₆₅H₂₆₁N₅₁O₅₅S₂
• Pureza: Min. 95%