Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
CAS: 133551-97-0
Ref. 3D-FB110162
10mg | 1.822,00 € | ||
25mg | 2.429,00 € | ||
50mg | 3.037,00 € | ||
100mg | 4.251,00 € | ||
250mg | 6.073,00 € |
Información del producto
- H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
Big endothelin-3 is a peptide that is a potent inhibitor of the endothelin receptor. It has been shown to inhibit the binding of endothelin to its receptors and antagonize the effects of endothelin on cells. Big endothelin-3 is a research tool for studying protein interactions, activators, and ligands. This product is the ammonium acetate salt form.
Propiedades químicas
Consulta técnica sobre: 3D-FB110162 Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.