5-Bromopicolinamide
CAS: 90145-48-5
Ref. 3D-FB153951
| 1g | A consultar | ||
| 2g | A consultar | ||
| 5g | A consultar | ||
| 10g | A consultar | ||
| 500mg | A consultar |
Información del producto
- 2-Pyridinecarboxamide, 5-Bromo-
5-Bromopicolinamide is a matrix-assisted laser desorption/ionization (MALDI) proteolytic peptide. It has been shown to be effective at cleaving myoglobin, which is an important part of the muscle protein that stores oxygen for use during exercise. 5-Bromopicolinamide is also able to detect the presence of phosphorylation sites on proteins. This compound is used as a substrate in MALDI mass spectrometry and has been successfully applied to the identification of phosphorylation sites on myoglobin and other proteins. The amino acid sequence of this compound has also been determined and annotated in databases such as UniProtKB/Swiss-Prot and NCBI Protein database.br>br>
br>
Sequences:
br>br>
METDVVELLHLEQLAQERELKLNVEGAEAVAKRRKDGLATTVSPSNTPGGGGRL
Propiedades químicas
Consulta técnica sobre: 3D-FB153951 5-Bromopicolinamide
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.
