(Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt
CAS: 1802080-88-1
Ref. 3D-FG109822
1mg | 376,00 € | ||
2mg | 574,00 € | ||
5mg | 1.018,00 € | ||
10mg | 1.714,00 € | ||
500µg | 236,00 € |
Información del producto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys -Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Gly-Gly-Cys-NH2 H-DA EFRHDSGYEVHHQKLVFFAEDVGSNGGC-NH2
Please enquire for more information about (Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propiedades químicas
Consulta técnica sobre: 3D-FG109822 (Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.