(Nle 35)-Amyloid b-Protein (1-42) ammonium salt
CAS: 1802086-51-6
Ref. 3D-FN110047
1mg | 526,00 € | ||
2mg | 865,00 € | ||
5mg | 1.607,00 € | ||
10mg | 2.785,00 € | ||
500µg | 343,00 € |
Información del producto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Nle-Val-Gly-Gly-Val-Val-Ile-Ala-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL(Nle)VGGVVIA-OH
Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propiedades químicas
Consulta técnica sobre: 3D-FN110047 (Nle 35)-Amyloid b-Protein (1-42) ammonium salt
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.