Prepro VIP (81-122) (human) trifluoroacetate salt
CAS: 111366-38-2
Ref. 3D-FP109989
1mg | 574,00 € | ||
2mg | 911,00 € | ||
5mg | 1.875,00 € | ||
250µg | 225,00 € | ||
500µg | 363,00 € |
Información del producto
- H-His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys- Lys-Tyr-Leu-Glu-Ser-Leu-Met-Gly-Lys-Arg-Val-Ser-S er-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val-OH H-HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV-OH
- Phv (1-42)
- Phv-42
- Prepro-vip (81-122)
- Preprovasoactive intestinal peptide (81-122)
- L-Valine, L-histidyl-L-alanyl-L-alpha-aspartylglycyl-L-valyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-phenylalanyl-L-seryl-L-lysyl-L-leucyl-L-leucylglycyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-L-seryl-L-leucyl-L-methionylglycyl-L-lysyl-L-arginyl-L-valyl-L-seryl-L-seryl-L-asparaginyl-L-isoleucyl-L-seryl-L-alpha-glutamyl-L-alpha-aspartyl-L-prolyl-L-valyl-L-prolyl-
Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propiedades químicas
Consulta técnica sobre: 3D-FP109989 Prepro VIP (81-122) (human) trifluoroacetate salt
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.