(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS: 215777-46-1
Ref. 3D-FS109310
1mg | 922,00 € | ||
2mg | 1.478,00 € | ||
5mg | 3.213,00 € | ||
250µg | 359,00 € | ||
500µg | 556,00 € |
Información del producto
- H-His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 H-HSE GTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
- 7-36-Glucagon-likepeptide 1 (Octodon degus), 8-L-serine-36-L-argininamide- (9CI)
- L-Argininamide, L-histidyl-L-seryl-L-a-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-a-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-a-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-a-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-
- (Ser79)-Proglucagon (78-107) Amide (Human, Bovine, Guinea Pig, Mouse, Rat) Trifluoroacetate Salt
- 22: PN:WO0155213 SEQID: 22 claimed sequence
Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propiedades químicas
Consulta técnica sobre: 3D-FS109310 (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.