
β-Defensin-3 (Human)
Ref. 3D-PDF-4382-S
100µg
1.030,00€

Información del producto
Nombre:β-Defensin-3 (Human)
Sinónimos:
- hBD-3Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly- Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly- Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-LysDEFB3GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKC
Marca:Biosynth
Descripción:β-Defensin-3 is a human peptide that belongs to the class of defensins. β-Defensin-3 is a potent activator of ion channels, and has been shown to be an inhibitor of ligand binding. β-Defensin-3 is also known to have antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus. This protein interacts with receptors, such as TNF receptor 1, and can be used as a research tool for studying protein interactions. β-Defensin 3 has been shown to inhibit the growth of tumor cells in vitro by interacting with the intracellular proteins, phosphatidylserine (PS) and annexin A2, which are involved in apoptosis.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.
Propiedades químicas
Peso molecular:5,155.1 g/mol
Fórmula:C216H371N75O59S6
Pureza:Min. 95%
Consulta técnica sobre: β-Defensin-3 (Human)
Use el carrito para solicitar presupuestos o pedidos
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.