H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
Ref. 3D-PP44439
1mg | 642,00 € | ||
10mg | 755,00 € | ||
100mg | 1.571,00 € |
Información del producto
- NH2-Tyr-Lys-Gln-Cys-His-Lys-Lys-Gly-Gly-His-Cys-Phe-Pro-Lys-Glu-Lys-Ile-Cys-Leu-Pro-Pro-Ser-Ser-Asp-Phe-Gly-Lys-Met-Asp-Cys-Arg-Trp- Arg-Trp-Lys-Cys-Cys-Lys-Lys-Gly-Ser-Gly-OH
Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH include the following: Pharmacological characterization of crotamine effects on mice hind limb paralysis employing both ex vivo and in vivo assays: Insights into the involvement of voltage SC Lima, LC Porta, acaÂC Lima - PLoS neglected , 2018 - journals.plos.orghttps://journals.plos.org/plosntds/article?id=10.1371/journal.pntd.0006700 Evaluation of crotamine based probes as intracellular targeted contrast agents for magnetic resonance imaging R Joshi, K Sweidan , D Jha, I Kerkis, K Scheffler - Bioorganic & Medicinal , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0968089622002553 In vivo effects of the association of the psychoactive phenotiazine thioridazine on antitumor activity and hind limb paralysis induced by the native polypeptide LC Porta, JD Campeiro , GB Papa, EB Oliveira - Toxicon, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0041010120302968 Unraveling the antifungal activity of a South American rattlesnake toxin crotamine ES Yamane, FC Bizerra, EB Oliveira , JT Moreira - Biochimie, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S030090841200377X Development of a New Cell Penetrating Peptide: Design, Synthesis and Applications D Jha - 2009 - ub01.uni-tuebingen.dehttps://ub01.uni-tuebingen.de/xmlui/handle/10900/49355
Propiedades químicas
Consulta técnica sobre: 3D-PP44439 H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.