H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Ref. 3D-PP47267
Tamaño no definido | A consultar |
Información del producto
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH include the following: EGFR S1166 phosphorylation induced by a combination of EGF and gefitinib has a potentially negative impact on lung cancer cell growth BF Assiddiq, KY Tan, W Toy, SP Chan - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr3002029
Propiedades químicas
Consulta técnica sobre: 3D-PP47267 H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.