H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Ref. 3D-PP47702
| Tamaño no definido | A consultar |
Información del producto
Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH include the following: Review of a current role of mass spectrometry for proteome research CHW Chen - Analytica chimica acta, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S000326700801132X Mass spectrometry for high-throughput proteome analysis and biomarker discovery CH Chen - Hiroshima Conference on Education and Science in - hiroshima-u.ac.jphttps://www.hiroshima-u.ac.jp/system/files/58163/5thHC_Proceedings.pdf#page=69
Propiedades químicas
Consulta técnica sobre: 3D-PP47702 H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.
