Información del producto
Nombre:NEP(1-40)
Sinónimos:
- H-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 NH2-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg- Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu- Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-amide
Marca:Biosynth
Descripción:Nogo-66 (1-40) is a peptide that is used as a research tool in cell biology, pharmacology and neuroscience. It is an inhibitor of the receptor for nerve growth factor (NGF), which has been shown to inhibit the activity of Nogo-A, a protein that prevents axonal growth. Nogo-66 (1-40) binds to the Nogo receptor on cells and blocks its ability to bind with NGF, preventing it from inhibiting axonal growth. This antibody can be used in research on ion channels, protein interactions and receptors.
Aviso:Nuestros productos están destinados únicamente para uso en laboratorio. Para cualquier otro uso, por favor contáctenos.
Propiedades químicas
Peso molecular:4,583.08 g/mol
Fórmula:C206H324N56O65
Consulta técnica sobre: NEP(1-40)
Use el carrito para solicitar presupuestos o pedidos
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.