Información del producto
- H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPP
H2N-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide is a catalog research peptide that is held in stock. This peptide is provided at >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer the product in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H2N-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide at the technical inquiry form on this page"
Propiedades químicas
Consulta técnica sobre: 3D-VAA-19699 Exendin 4
Si desea solicitar un presupuesto o realizar un pedido, por favor añada los productos deseados a su carrito y solicite un presupuesto o pedido desde el carrito. Es más rápido, más barato, y podrá beneficiarse de los descuentos y las ventajas disponibles.