CAS 12279-41-3

Séractide

Description :

Séractide, avec le numéro CAS 12279-41-3, est un composé chimique principalement connu pour son application dans le domaine de la pharmacie et de la biochimie. C'est un tensioactif synthétique qui présente des propriétés telles que l'émulsification, l'humectation et la dispersion, ce qui le rend utile dans diverses formulations. Séractide est souvent utilisé dans la préparation de systèmes de délivrance de médicaments, améliorant la solubilité et la biodisponibilité de composés peu solubles. Sa nature amphiphile lui permet d'interagir avec des substances à la fois hydrophiles et hydrophobes, facilitant la stabilisation des émulsions et des suspensions. De plus, Séractide peut posséder une activité biologique, contribuant à son rôle dans l'amélioration de l'efficacité des agents thérapeutiques. Les précautions de sécurité et de manipulation sont essentielles lors de la manipulation de ce composé, comme c'est le cas pour de nombreux tensioactifs, en raison de ses propriétés irritantes potentielles. Dans l'ensemble, Séractide sert d'outil précieux dans les formulations pharmaceutiques et la recherche, contribuant aux avancées dans les technologies de délivrance de médicaments.

Formule : C₂₀₇H₃₀₈N₅₆O₅₈S₁

Synonymes :

• L-Seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-asparaginylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine
• Acth(1-39)
• CORTICOTROPIN (HUMAN)
• ACTH (1-39), HUMAN
• Seractide USP/EP/BP
• H-SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE-OH
• ADRENOCORTICOTROPIC HORMONE (1-39) (HUMAN)
• Seractide
• CORTICOTROPIN A
• REF DUPL: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
• ACTH (1-39) (huMan)
• Adrenocorticotropic hormone fragment 1-39, ≥97% (HPLC)
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE
• ACTH (1-39) (human) trifluoroacetate salt H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt
• Adrenocorticotropic Hormone (ACTH) (1-39)
• H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
• Seractide ACTH
• Adrenocorticotropic Hormone (ACTH) (1-39), human
• Seractide acetate
• PCorticotropin (Human) CAS 12279-41-3
• ACTH
• M.W. 4541.07 C207H308N56O58S
• CORTICOTROPHIN
• Corticotropin
• adrenocorticotropic hormone fragment 1-39
• SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN
• ADRENOCORTICOTROPIC HORMONE HUMAN

ACTH (1-39) (human)

CAS : 12279-41-3

The major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.

Formule : C₂₀₇H₃₀₈N₅₆O₅₈S

Degré de pureté : 99.2%

Couleur et forme : White

Masse moléculaire : 4541.13

Ref: 01-4030325

a1-39-Corticotropin (human)

CAS : 12279-41-3

Formule : C₂₀₇H₃₀₈N₅₆O₅₈S

Degré de pureté : 98%

Couleur et forme : Solid

Masse moléculaire : 4541.0658

Ref: IN-DA01CP9W

ACTH (1-39) human

CAS : 12279-41-3

Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH (1-39), human) is an agonist of melanocortin receptor.

Formule : C₂₀₇H₃₀₈N₅₆O₅₈S

Degré de pureté : 99.6%

Couleur et forme : White Lyophilised Solid

Masse moléculaire : 4541.14

Ref: TM-T8231

ACTH(1-39) trifluoroacetate

CAS : 12279-41-3

ACTH(1-39) trifluoroacetate is a synthetic form of ACTH that is used for the diagnosis of autoimmune diseases and bowel disease. It is also used to assess the function of the adrenal gland in cases of suspected Cushing's syndrome. The blood sampling procedure involves withdrawing a small amount of blood from the patient and adding ACTH(1-39) trifluoroacetate to it, which causes an increase in cortisol concentration. ACTH(1-39) trifluoroacetate binds to corticotropin receptors on cells in the body, causing them to release basic proteins that are responsible for inflammation. This drug may be a potential biomarker for metabolic disorders such as obesity. It has been shown to have anti-inflammatory properties and can be used as a nonsteroidal anti-inflammatory drug (NSAID).

Formule : C₂₀₇H₃₀₈N₅₆O₅₈S

Degré de pureté : Min. 98 Area-%

Couleur et forme : Powder

Masse moléculaire : 4,541.07 g/mol

Ref: 3D-FA108368