CAS 133514-43-9

fragment d'exendine 9-39

Description :

fragment d'exendine 9-39 est un peptide dérivé de la molécule exendine-4, qui est un analogue du peptide-1 semblable au glucagon (GLP-1). Ce fragment spécifique est connu pour son rôle d'antagoniste compétitif du récepteur GLP-1, qui est significatif dans la régulation du métabolisme du glucose et de la sécrétion d'insuline. Le peptide est composé de 31 acides aminés et se caractérise par sa capacité à inhiber les actions du GLP-1, ce qui en fait un sujet d'intérêt dans la recherche sur le diabète et les applications thérapeutiques potentielles. Sa structure comprend une séquence qui lui permet de se lier au récepteur GLP-1, mais contrairement au GLP-1, il n'active pas le récepteur, bloquant ainsi ses effets. Le numéro CAS 133514-43-9 identifie de manière unique ce composé dans les bases de données chimiques, facilitant son étude et son application dans des contextes pharmacologiques. Dans l'ensemble, fragment d'exendine 9-39 sert d'outil précieux pour comprendre la signalisation du récepteur GLP-1 et ses implications dans les troubles métaboliques.

Formule : C₁₄₉H₂₃₄N₄₀O₄₇S

Synonymes :

• Exendin (9-39)
• Exendin(9-39)amide
• Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine-
• H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• Exendin-3 (9-39) amide USP/EP/BP
• H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt
• Exendin Fragment 9-39 >=95% (HPLC)
• 9-39-Exendin 3(Heloderma horridum) (9CI)
• EXENDIN-3 (9-39) AMIDE
• H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
• 9-39-Exendin 3(Heloderma horridum)
• DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• L-Serinamide, L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-p...
• Exendin 4 (9-39) amide
• ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• M.W. 3369.79 C149H234N40O47S
• Exendin FragMent 9-39Exendin
• ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• EXENDIN [9-39] PEPTIDE
• EXENDIN FRAGMENT 9-39
• EXENDIN FRAGMENT 9-39;EXENDIN (9-39)
• Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRp-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2, ≥95%(HPLC)
• Exendin (9-39) Acetate

Exendin (9-39)

CAS : 133514-43-9

For cellular and molecular biology applications

Formule : C₁₄₉H₂₃₄N₄₀O₄₇S

Masse moléculaire : 3369.75

Ref: 02-J66126

Exendin (9-39)

CAS : 133514-43-9

Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide and of exendin-4 on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.

Formule : C₁₄₉H₂₃₄N₄₀O₄₇S

Degré de pureté : 97.4%

Couleur et forme : White Powder

Masse moléculaire : 3369.8

Ref: 01-4017799

Exendin (9-39)

CAS : 133514-43-9

Formule : C₁₄₉H₂₃₄N₄₀O₄₇S

Degré de pureté : 99%

Couleur et forme : Solid

Masse moléculaire : 3369.7571

Ref: IN-DA00ILPD

Exendin Fragment 9-39

CAS : 133514-43-9

Formule : C₁₄₉H₂₃₄N₄₀O₄₇S

Degré de pureté : ≥ 95.0%

Couleur et forme : White powder

Masse moléculaire : 3369.75

Ref: 7W-GK0935

Avexitide

CAS : 133514-43-9

Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.

Formule : C₁₄₉H₂₃₄N₄₀O₄₇S

Degré de pureté : 98% - 99.65%

Couleur et forme : Solid

Masse moléculaire : 3369.76

Ref: TM-TP2100

Exendin (9-39)

CAS : 133514-43-9

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Formule : C₁₄₉H₂₃₄N₄₀O₄₇S

Masse moléculaire : 3,369.79 g/mol

Ref: 3D-PP50554

Exendin (9-39) acetate

CAS : 133514-43-9

Exendin (9-39) acetate is a peptide hormone that is derived from the salivary gland of the Gila monster. It binds to receptors in the pancreas and inhibits insulin release. Exendin (9-39) acetate has been shown to increase glomerular filtration rate, natriuresis, and plasma glucose levels in animals. This peptide also increases soluble guanylate cyclase activity, which leads to an increase in cellular cGMP levels and vasodilation. Exendin (9-39) acetate has been shown to inhibit the production of cyclic guanosine monophosphate (cGMP) by inhibiting adenylyl cyclase activity. It also binds to receptors on pancreatic beta cells and inhibits insulin release, as well as binding to receptors on vascular smooth muscle cells and causing vasodilation.

Formule : C₁₄₉H₂₃₄N₄₀O₄₇S

Degré de pureté : Min. 95%

Masse moléculaire : 3,369.76 g/mol

Ref: 3D-FE110341