CymitQuimica logo

CAS 86784-80-7

:

facteur de libération de la corticotropine humain

Description :
Le facteur de libération de la corticotropine (CRF), spécifiquement la variante humaine avec le numéro CAS 86784-80-7, est une hormone peptidique impliquée dans la réponse au stress. Il est principalement produit dans l'hypothalamus et joue un rôle crucial dans l'axe hypothalamo-hypophyso-surrénalien (HPA) en stimulant la libération de l'hormone adrénocorticotrope (ACTH) par la glande pituitaire. Le CRF est composé de 41 acides aminés et se caractérise par sa capacité à se lier à des récepteurs spécifiques, à savoir les récepteurs CRF 1 et 2, qui sont impliqués dans divers processus physiologiques, y compris la réponse au stress, l'anxiété et la régulation des rythmes circadiens. La substance se trouve généralement sous forme soluble et est sensible aux conditions environnementales telles que la température et le pH. Son activité biologique est essentielle pour maintenir l'homéostasie et répondre aux stress, ce qui en fait un sujet de recherche important en neurobiologie et en endocrinologie. De plus, le CRF a des implications dans divers troubles psychiatriques, soulignant son importance tant pour la santé que pour la maladie.
Formule :C208H344N60O63S2
InChI :InChI=1/C208H343N59O64S2/c1-30-106(20)161(263-198(323)147-49-41-75-266(147)204(329)148-50-42-76-267(148)203(328)132(59-68-158(286)287)246-179(304)126(55-64-154(278)279)235-169(294)117(210)93-268)200(325)260-146(95-270)197(322)253-137(83-102(12)13)189(314)256-144(90-159(288)289)194(319)252-139(85-104(16)17)195(320)265-164(113(27)271)202(327)258-140(86-114-43-34-33-35-44-114)190(315)254-142(88-116-92-222-97-227-116)191(316)251-136(82-101(10)11)188(313)250-135(81-100(8)9)185(310)237-121(48-40-74-225-208(219)220)175(300)241-128(57-66-156(282)283)182(307)261-160(105(18)19)199(324)257-138(84-103(14)15)187(312)242-127(56-65-155(280)281)178(303)244-130(69-77-332-28)172(297)230-109(23)165(290)232-119(46-38-72-223-206(215)216)170(295)228-110(24)166(291)234-125(54-63-153(276)277)177(302)240-124(53-62-151(213)274)180(305)248-133(79-98(4)5)184(309)231-111(25)167(292)233-123(52-61-150(212)273)176(301)239-122(51-60-149(211)272)171(296)229-112(26)168(293)247-141(87-115-91-221-96-226-115)192(317)259-145(94-269)196(321)255-143(89-152(214)275)193(318)238-120(47-39-73-224-207(217)218)174(299)236-118(45-36-37-71-209)173(298)245-131(70-78-333-29)181(306)249-134(80-99(6)7)186(311)243-129(58-67-157(284)285)183(308)262-162(107(21)31-2)201(326)264-163(205(330)331)108(22)32-3/h33-35,43-44,91-92,96-113,117-148,160-164,268-271H,30-32,36-42,45-90,93-95,209-210H2,1-29H3,(H2,211,272)(H2,212,273)(H2,213,274)(H2,214,275)(H,221,226)(H,222,227)(H,228,295)(H,229,296)(H,230,297)(H,231,309)(H,232,290)(H,233,292)(H,234,291)(H,235,294)(H,236,299)(H,237,310)(H,238,318)(H,239,301)(H,240,302)(H,241,300)(H,242,312)(H,243,311)(H,244,303)(H,245,298)(H,246,304)(H,247,293)(H,248,305)(H,249,306)(H,250,313)(H,251,316)(H,252,319)(H,253,322)(H,254,315)(H,255,321)(H,256,314)(H,257,324)(H,258,327)(H,259,317)(H,260,325)(H,261,307)(H,262,308)(H,263,323)(H,264,326)(H,265,320)(H,276,277)(H,278,279)(H,280,281)(H,282,283)(H,284,285)(H,286,287)(H,288,289)(H,330,331)(H4,215,216,223)(H4,217,218,224)(H4,219,220,225)
SMILES :CCC(C)C(C(=NC(CO)C(=NC(CC(C)C)C(=NC(CC(=O)O)C(=NC(CC(C)C)C(=NC(C(C)O)C(=NC(Cc1ccccc1)C(=NC(Cc1cnc[nH]1)C(=NC(CC(C)C)C(=NC(CC(C)C)C(=NC(CCCNC(=N)N)C(=NC(CCC(=O)O)C(=NC(C(C)C)C(=NC(CC(C)C)C(=NC(CCC(=O)O)C(=NC(CCSC)C(=NC(C)C(=NC(CCCNC(=N)N)C(=NC(C)C(=NC(CCC(=O)O)C(=NC(CCC(=N)O)C(=NC(CC(C)C)C(=NC(C)C(=NC(CCC(=N)O)C(=NC(CCC(=N)O)C(=NC(C)C(=NC(Cc1cnc[nH]1)C(=NC(CO)C(=NC(CC(=N)O)C(=NC(CCCNC(=N)N)C(=NC(CCCCN)C(=NC(CCSC)C(=NC(CC(C)C)C(=NC(CCC(=O)O)C(=NC(C(C)CC)C(=NC(C(C)CC)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C(C1CCCN1C(=O)C1CCCN1C(=O)C(CCC(=O)O)N=C(C(CCC(=O)O)N=C(C(CO)N)O)O)O
Synonymes :
  • Corticotropin-Releasing Factor, Human and Rat
  • Crf (Human, Rat)
  • Corticotropin-Releasing Factor, human, rat
  • corticotropin-releasinghormone(human)
  • humancrf(1-41)
  • H-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2
  • CRF(human,Rat) Acetate
  • Corticotropin-releasing factor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine- 25-L-glutamic acid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide-
  • CRH
  • ratcorticotropin-releasingfactor-41
  • Voir plus de synonymes
Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
11 produits concernés.
  • Corticotropin-Releasing Factor, human, rat

    CAS :
    Corticotropin-Releasing Factor, human, rat
    Couleur et forme :White to off-white, Powder or crystals or crystalline powder

    Ref: 02-J66835

    ne
    À demander
  • CRF (human, rat)

    CAS :
    CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.
    Formule :C208H344N60O63S2
    Degré de pureté :≥ 99%
    Couleur et forme :White
    Masse moléculaire :4757.52

    Ref: 01-4011473

    1mg
    375,00€
    5mg
    1.421,00€
  • Corticotropin-releasing factor (human)

    CAS :
    Formule :C208H344N60O63S2
    Degré de pureté :95%
    Couleur et forme :Solid
    Masse moléculaire :4757.4512

    Ref: IN-DA01CB8Y

    5mg
    À demander
    1mg
    291,00€
    2.5mg
    606,00€
  • Corticotropin-releasing factor (human)

    CAS :
    Human CRF is a neuropeptide that releases ACTH, stimulates the nervous system, and antagonizes inflammation.
    Formule :C208H344N60O63S2
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :4757.45

    Ref: TM-TP1144

    200µg
    740,00€
  • Corticotropin Releasing Factor

    CAS :
    Corticotropin Releasing Factor
    Couleur et forme :Solid

    Ref: 54-BIBA1036

    ne
    À demander
  • Corticotropin-releasing Factor Trifluoroacetic Acid Salt (Human, rat) (Technical Grade)

    Produit contrôlé
    CAS :

    Applications Corticotropin-releasing Factor (Human, rat) is a 41-amino-acid neuropeptide responsible for endocrine, autonomic, immunology and behavioral responses of mammals to stress. Corticotropin-releasing Factor (Human, rat) has an inhibitory effect on in vitro fertilized oocytes, resulting from cultured preantral follicles at all stages of preimplantation embryo development
    References Dinopoulou, V., et. al.: Endocrin., 154, 222 (2013)

    Formule :C208H344N60O63S2·xC2HF3O2
    Couleur et forme :Neat
    Masse moléculaire :4757.45

    Ref: TR-C695750

    1mg
    281,00€
    10mg
    1.510,00€
  • CRF (human, rat) acetate

    CAS :

    CRF (human, rat) acetate is a synthetic chemical that has been shown to produce long-term changes in the brain. It is chemically similar to CRF, which is an endogenous hormone produced by the hypothalamus. This drug is used for the treatment of cerebral edema and intracranial hypertension caused by various conditions, such as cancer. The effects of CRF (human, rat) acetate on humans are not well understood as this drug has only been tested in women who have undergone surgery to remove their ovaries. These women had increased levels of corticotropin-releasing hormone (CRH), which could be due to CRF (human, rat) acetate or its metabolites. There is also some evidence that it may cause corrosion in long-term use.

    Formule :C208H344N60O63S2
    Degré de pureté :Min. 95%
    Couleur et forme :White Powder
    Masse moléculaire :4,757.46 g/mol

    Ref: 3D-FC108671

    1mg
    479,00€
    2mg
    711,00€
    5mg
    1.058,00€
    10mg
    1.692,00€
    25mg
    2.472,00€
  • CRF (human, rat)

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C208H344N60O63S2
    Masse moléculaire :4,758 g/mol

    Ref: 3D-PP50518

    ne
    À demander
  • CRF (Human, Rat)

    CAS :
    Corticotropin-Releasing Factor (CRF) (Human, Rat) is a peptide hormone product that is available as a 0.5mg vial and has the potential to be used as a research tool to study the effects of CRF in the body. CRF is a natural hormone that regulates many physiological processes, such as blood pressure, temperature control, and food intake. CRF binds to receptors on cells and triggers a number of cellular responses within the cell. This peptide can be used for pharmacological studies or for antibody production.
    Formule :C208H344N60O63S2
    Degré de pureté :Min. 95%
    Masse moléculaire :4,757.5 g/mol

    Ref: 3D-PCR-4136-V

    500µg
    1.605,00€
  • CRF (Human, Rat)

    CAS :

    A (Human, Rat) Corticotropin-Releasing Factor (CRF) product available as a 0.1mg vial. As a peptide hormone CRF regulates the hypothalamic-pituitary adrenal (HPA) axis. The hypothalamus releases CRF during stress and in turn CRF stimulates the production of stress hormones such as glucocorticoids and adrenocorticotropin (ACTH). Glucocorticoids are then involved in a negative feedback loop, in that they prevent the pituitary gland and hypothalamus from exhibiting any further endocrine activity. The overproduction of CRF due to the overstimulation of the hypothalamic-pituitary adrenal axis has been shown to cause symptoms seen in patients with depression. Furthermore studies have shown the expression of CRF receptors in glial cells and T-cells and elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments.

    Formule :C208H344N60O63S2
    Degré de pureté :Min. 95%
    Masse moléculaire :4,757.5 g/mol

    Ref: 3D-PCR-4136-S

    100µg
    534,00€