
CAS 9015-71-8
:Facteur de libération de la corticotropine
Description :
Facteur de libération de la corticotropine (CRF), également connu sous le nom d'hormone de libération de la corticotropine (CRH), est une hormone peptidique impliquée dans la réponse au stress. Elle est produite dans l'hypothalamus et joue un rôle crucial dans l'axe hypothalamo-hypophyso-surrénalien (HPA) en stimulant la libération de l'hormone adrénocorticotrope (ACTH) par la glande pituitaire. Le CRF est composé de 41 acides aminés et présente une gamme d'activités biologiques, y compris la modulation de la réponse immunitaire et l'influence sur le comportement et l'humeur. La substance se caractérise par sa capacité à se lier à des récepteurs spécifiques, à savoir les récepteurs CRF 1 et 2, qui sont répartis dans tout le cerveau et les tissus périphériques. Le CRF est également impliqué dans divers processus physiologiques, y compris la régulation des rythmes circadiens et la réponse aux stress. Sa dysrégulation est associée à plusieurs troubles psychiatriques et physiologiques, ce qui en fait une cible pour la recherche sur les conditions liées au stress. Le numéro CAS 9015-71-8 identifie de manière unique ce peptide dans les bases de données chimiques, facilitant son étude et son application dans la recherche biomédicale.
Formule :C205H339N59O63S1
Synonymes :- ACTH - releasing factor
- ACTH-releasing hormone
- CRF
- CRF (hormone)
- CRH
- Corticoliberin
- Corticotrophin-releasing hormone
- Corticotropin-Releasing Hormone
- Corticotropin-releasing activity
- Corticotropin-releasing hormone-41
- Crf (Ovine)
- Crf-41
- Corticotropin-releasing factor
- Corticotropin-releasing factor
- CORTICOTROPIN RELEASING FACTOR SHEEP
- corticotropin-releasinghormone))-
- H-SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2
- SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2 OVINE
- Corticotropin releasing factor 41
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
- SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2
- Corticorelin Ovine (x = 4.1-8.2)
- Corticotropin Releasing Factor sheep, ≥95% (HPLC)
- CRF, CRH
- Corticotropin Releasing Factor, CRF, ovine
- CORTICOTROPIN RELEASING FACTOR, OVINE
- Voir plus de synonymes
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
2 produits concernés.
CRF (Ovine)
CAS :<p>Corticotropin Releasing Factor (CRF) is a peptide hormone involved in the regulation of the neuroendocrine system, the hypothalamic-pituitary-adrenal (HPA) axis. The hypothalamus releases CRF during stress and in turn CRF stimulates the production of stress hormones such as glucocorticoids and adrenocorticotropin (ACTH). A negative feedback loop is created as glucocorticoids then prevents further endocrine activity exhibited by the pituitary gland and hypothalamus. Interestingly in patients with depression, it has been found that the hypothalamic-pituitary adrenal axis is over stimulated thus increased production of CRF occurs resulting in depression symptoms. Furthermore studies have shown the expression of CRF receptors in glial cells and T-cells and elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments. <br>This product is available as a 0.1mg vial.</p>Formule :C205H339N59O63SDegré de pureté :Min. 95%Masse moléculaire :4,670.3 g/molCRF (Ovine)
CAS :<p>This product is an ovine, Corticotropin Release Factor (CRF) and is available as a 0.5mg vial. CRF is a peptide hormone and a key regulator of the hypothalamic-pituitary adrenal (HPA) axis. In response to stress the hypothalams releases CRF which stimulates the production of glucocorticoids and adrenocorticotropin, which are stress hormones. Glucocorticoids are then involved in a negative feedback loop, in that they prevent the pituitary gland and hypothalamus from exhibiting any further endocrine activity. Studies have shown that symptoms of depression can be caused by the over production of CRF due to the overstimulation of the hypothalamic-pituitary adrenal axis. Interestingly CRF receptors are expressed in both glial cells and T cells. Elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments.</p>Formule :C205H339N59O63SDegré de pureté :Min. 95%Masse moléculaire :4,670.3 g/mol
