CAS 90880-35-6

neuropeptide Y humain

Description :

Le neuropeptide Y (NPY) est un peptide de 36 acides aminés qui joue un rôle crucial dans divers processus physiologiques, y compris la régulation de l'appétit, les rythmes circadiens et la réponse au stress. Il est principalement produit dans le système nerveux central et est impliqué dans la neurotransmission. La forme humaine du neuropeptide Y, identifiée par le numéro CAS 90880-35-6, présente un haut degré de conservation entre les espèces, ce qui indique son importance biologique fondamentale. Le NPY fonctionne en se liant à des récepteurs spécifiques, principalement les récepteurs Y1 et Y2, qui sont des récepteurs couplés aux protéines G. Cette liaison peut influencer une gamme de réponses cellulaires, y compris la modulation de la libération de neurotransmetteurs et la régulation de l'équilibre énergétique. De plus, le NPY est impliqué dans diverses conditions pathologiques, telles que l'obésité, l'anxiété et la dépression, ce qui en fait une cible pour la recherche thérapeutique. Sa stabilité et sa bioactivité sont influencées par des facteurs tels que les modifications post-traductionnelles et la présence de sous-types de récepteurs spécifiques, soulignant sa complexité en tant que molécule de signalisation dans le système nerveux.

Formule : C₁₈₉H₂₈₄N₅₅O₅₇RS

Synonymes :

• Neuropeptide Y (human), 36-L-tyrosine-
• NeuropeptideY (pig), 17-L-methionine-36-L-tyrosine-
• Neuropeptide Y, Human
• NEUROPEPTIDE Y (HUMAN, RAT) USP/EP/BP
• hnpy
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
• REF DUPL: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• Neuropeptide Y (29-64), amide, human
• Neuropeptide Y (huMan, rat)
• hNPY, NPY
• Neuropeptide Y (Alligator mississippiensis)
• Neuropeptide Y (human, rat) Acetate
• NEUROPEPTIDE Y (HUMAN, RAT)
• Human neuropeptide Y (29-64)
• YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
• M.W. 4271.68 C189H285N55O57S
• Neuropeptide Y (rat)
• NPY (HUMAN, RAT)
• H-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-OH
• NPY FREE ACID (HUMAN, RAT)
• Neuropeptide Y (Gopherus agassizii)
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• NEUROPEPTIDE Y FREE ACID (HUMAN, RAT)
• Neuropeptide Y (human pheochromocytoma)
• NPY (huMan, rat)
• TYP-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR
• Neuropeptide Y(1-36)

Neuropeptide Y, Human

CAS : 90880-35-6

For cellular and molecular biology applications

Formule : C₁₈₉H₂₈₅N₅₅O₅₇S

Masse moléculaire : 4271.74

Ref: 02-J66797

Neuropeptide Y (human, rat)

CAS : 90880-35-6

Bachem ID: 4012616.

Formule : C₁₈₉H₂₈₅N₅₅O₅₇S

Degré de pureté : 95.2%

Couleur et forme : White

Masse moléculaire : 4271.74

Ref: 01-4012616

Neuropeptide Y (human, rat)

CAS : 90880-35-6

Formule : C₆₅H₁₄₂N₂₆O₃

Degré de pureté : 98%

Masse moléculaire : 1335.9954

Ref: IN-DA00GRZM

Neuropeptide Y (human)

CAS : 90880-35-6

Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.

Formule : C₁₈₉H₂₈₅N₅₅O₅₇S

Degré de pureté : 98%

Couleur et forme : Solid

Masse moléculaire : 4271.68

Ref: TM-TP1140

Neuropeptide Y

CAS : 90880-35-6

Neuropeptide Y

Ref: 54-BIBA1035

NPY (Human, Rat)

CAS : 90880-35-6

NPY is a potent inhibitor of the ion channel TRPM2. This protein has been shown to be involved in a variety of physiological functions, including regulation of body weight and food intake, sleep-wake cycles, and pain perception. It is also an important regulator of neuronal excitability. NPY (Human) can be used as a research tool for studying protein interactions or investigating the function of ion channels in cellular systems. NPY (Rat) can be used as an antibody for immunohistochemistry or Western blotting experiments.

Formule : C₁₈₉H₂₈₅N₅₅O₅₇S

Degré de pureté : Min. 95%

Masse moléculaire : 4,271.7 g/mol

Ref: 3D-PNP-4158-S

Neuropeptide Y, human

CAS : 90880-35-6

Neuropeptide Y is a potent neuropeptide that regulates many biological processes in vertebrates. It has been shown to regulate various processes, including feeding, anxiety, reproduction, and pain. Neuropeptide Y is synthesized as an amide of the amino acid L-tyrosine. The synthetic peptide can be either enantiomer or a mixture of both enantiomers. The presence of neuropeptides Y in the extracellular fluid is potently regulated by the neuropeptide Y receptor subtype 2 (Y2R). Neuropeptide Y has been shown to inhibit egg development in mosquitoes when injected into their ovaries at high doses. This effect was dose-dependent and was mediated by receptors on the surface of cho-k1 cells (a rat kidney cell line). The homologues of neuropeptide Y are called peptides PYY and PYY3-36.

Formule : C₁₈₉H₂₈₅N₅₅O₅₇S

Degré de pureté : Min. 95%

Masse moléculaire : 4,271.69 g/mol

Ref: 3D-FN73521

Neuropeptide Y (human, rat) trifluoroacetate salt

CAS : 90880-35-6

Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Formule : C₁₈₉H₂₈₅N₅₅O₅₇S

Degré de pureté : Min. 95%

Masse moléculaire : 4,271.69 g/mol

Ref: 3D-FN109816

NPY (Human, Rat)

CAS : 90880-35-6

NPY (Human, Rat) is a peptide that belongs to the family of neuropeptides. It is a central neurotransmitter and neuromodulator in the brain and has an important role in the regulation of many physiological processes, including feeding behavior, body weight, blood pressure, stress responses and reproduction. NPY (Human, Rat) is used as a research tool for studying ion channels and receptor interactions. This product is also used to develop antibodies that can be used as a research tool or diagnostic reagent. NPY (Human, Rat) is not active when taken orally; it must be injected into the body.

Formule : C₁₈₉H₂₈₅N₅₅O₅₇S

Degré de pureté : Min. 95%

Masse moléculaire : 4,271.7 g/mol

Ref: 3D-PNP-4158-V