
Récepteur du glucagon
Les récepteurs du glucagon sont des GPCR qui médiatisent les effets du glucagon, une hormone impliquée dans la régulation de l'homéostasie du glucose en favorisant la dégradation du glycogène et la libération de glucose par le foie. Ces récepteurs sont essentiels dans la gestion des niveaux de sucre dans le sang et sont particulièrement intéressants dans l'étude du diabète et des troubles métaboliques. Les antagonistes des récepteurs du glucagon sont explorés comme traitements potentiels de l'hyperglycémie dans le diabète de type 2. Chez CymitQuimica, nous offrons une variété de modulateurs de récepteurs du glucagon de haute qualité pour soutenir vos recherches en endocrinologie, diabète et régulation métabolique.
164 produits trouvés pour "Récepteur du glucagon"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Crotedumab
CAS :<p>Crotedumab (REGN1193) is a humanized antibody targeting GCGR, which reduces fasting blood glucose and improves glucose tolerance, used in diabetes research.</p>Degré de pureté :>95%Couleur et forme :LiquidVolagidemab
CAS :<p>Anti-CD34 Antibody is a CHO-expressed humanized monoclonal antibody targeting CD34, which can be used for the study of neurological and cardiovascular diseases.</p>Degré de pureté :97.8% (SDS-PAGE); 98% (SEC-HPLC) - 97.8% (SDS-PAGE); 98% (SEC-HPLC)Couleur et forme :LiquidGlucagon (1-29), bovine, human, porcine hydrochloride
CAS :<p>Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon increases HNF4α phosphorylation.</p>Formule :C153H225N43O49S·ClHDegré de pureté :95.65% - 98.03%Couleur et forme :SolidMasse moléculaire :3519.21Retatrutide sodium salt
<p>Retatrutide sodium salt is a glucagon receptor and glucagon-like peptide-1 receptor agonist for the study of type 2 diabetes mellitus.</p>Degré de pureté :99.97%Couleur et forme :SoildPF-06882961
CAS :<p>PF-06882961 is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Formule :C31H30FN5O4Degré de pureté :98.06% - 99.54%Couleur et forme :SolidMasse moléculaire :555.6Tirzepatide monosodium salt
<p>Tirzepatide sodium salt (LY3298176 sodium salt) is a GIP and GLP-1 receptor agonist with neuroprotective activity and can be used to treat obesity.</p>Formule :C225H347N48O68NaDegré de pureté :99.69%Couleur et forme :SoildMasse moléculaire :4835.51Retatrutide
CAS :<p>Retatrutide (LY3437943) is a triple agonist of GCGR, GIPR and GLP-1R that can be used to study obesity.</p>Formule :C221H342N46O68Degré de pureté :98.31%Couleur et forme :SolidMasse moléculaire :4732.09Avexitide acetate
CAS :<p>Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.</p>Formule :C155H246N40O53SDegré de pureté :96.64% - 98.65%Couleur et forme :SolidMasse moléculaire :3549.91(S, R)-LSN 3318839
CAS :<p>(S,R)-LSN 3318839 enhances GLP-1R, shows strong blood sugar lowering in animals, works with sitagliptin.</p>Formule :C26H23Cl2N3O2Degré de pureté :99.57%Couleur et forme :SoildMasse moléculaire :480.39GLP-1R Agonist DMB
CAS :<p>GLP-1R Agonist DMB is an agonist of glucagon-like peptide 1 receptor (GLP-1R; KB = 26.3 nM for the recombinant human receptor).</p>Formule :C13H15Cl2N3O2SDegré de pureté :99.52%Couleur et forme :SolidMasse moléculaire :348.25GLP-1R Antagonist 1
CAS :<p>GLP-1R Antagonist 1 is an orally active, CNS penetrant and non-competitive glucagon-like peptide 1 receptor (GLP-1R) antagonist (IC50: 650 nM).</p>Formule :C16H11ClF6N4O2Degré de pureté :99.84%Couleur et forme :SolidMasse moléculaire :440.73HAEGTFTSD
CAS :<p>HAEGTFTSD is GLP-1's initial segment; GLP-1 (7-36) amide, tied to food intake, stems from preproglucagon in L-cells.</p>Formule :C40H57N11O17Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :963.94Tirzepatide
CAS :<p>Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.</p>Formule :C225H348N48O68Degré de pureté :99.52% - 99.99%Couleur et forme :SolidMasse moléculaire :4813.45HAEGT
CAS :<p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>Formule :C20H31N7O9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :513.5Glucagon receptor antagonists-1
CAS :<p>Glucagon receptor antagonist -1 is a highly effective glucagon receptor antagonist.</p>Formule :C29H34FNO2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :447.58V-0219 hydrochloride
<p>V-0219 hydrochloride: oral GLP-1R PAM for obesity-linked diabetes study.</p>Formule :C20H26ClF3N4O2Degré de pureté :99.97%Couleur et forme :SoildMasse moléculaire :446.89Orforglipron
CAS :<p>Orforglipron (LY3502970; GLP-1 receptor agonist 1) is an orally available glucagon-like peptide (GLP-1) receptor agonist for the study of obesity and type 1</p>Formule :C48H48F2N10O5Degré de pureté :99.47% - 99.8%Couleur et forme :SolidMasse moléculaire :882.96GLP-1 moiety from Dulaglutide
<p>GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.</p>Formule :C149H221N37O49Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3314.62HAEGTFTSD acetate(926018-45-3 free base)
<p>HAEGTFTSD acetate is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted from</p>Formule :C42H61N11O19Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1024.01GLP-1 receptor agonist 13
<p>Compound (S)-9, a GLP-1 receptor agonist, exhibits an EC50 of 76 nM for the glucagon GLP-1 receptor [1].</p>Formule :C25H23ClF2N6OCouleur et forme :SolidMasse moléculaire :496.94Albiglutide Fragment
CAS :<p>Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).</p>Formule :C148H224N40O45Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3283.66α-Methylprednisolone 21-hemisuccinate sodium salt
CAS :<p>6α-Methylprednisolone 21-hemisuccinate sodium salt (Asmacortone), a water-soluble ester, is used for allergic, cardiac, and hypoxic emergencies.</p>Formule :C26H33NaO8Degré de pureté :99.65%Couleur et forme :Lyophilized PowderMasse moléculaire :496.53Cinnamtannin A2
CAS :<p>Cinnamtannin A2, a tetrameric procyanidin, boosts GLP-1, insulin, CRH expression, and has antioxidant, anti-diabetic, nephroprotective properties.</p>Formule :C60H50O24Couleur et forme :SolidMasse moléculaire :1155.02Tirzepatide hydrochloride
<p>Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.</p>Formule :C225H349N48O68ClDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4849.91Survodutide TFA
<p>Survodutide TFA (BI 456906 TFA) is a GCGR/GLP-1R dual agonist, a peptide compound used in obesity research.</p>Formule :C192H289N47O61·xC2HF3OC2Degré de pureté :99.29% - 99.96%Couleur et forme :SolidMasse moléculaire :4231.62 (free base)Secretin (28-54), human TFA
<p>Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.</p>Formule :C132H221N44F3O42Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3153.48VU0453379
CAS :<p>VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).</p>Formule :C26H34N4O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :434.57GLP-1 receptor agonist 4
CAS :<p>GLP-1 receptor agonist 4 targets GLP-1R, EC50 64.5 nM, potential diabetes treatment research.</p>Formule :C51H44Cl2N4O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :879.82Glucagon (19-29), human
CAS :<p>Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.</p>Formule :C61H89N15O18SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1352.53GLP-1R agonist 19
CAS :<p>GLP-1R agonist 19 (M3190) is a potent, selective GLP-1 receptor agonist that demonstrates excellent plasma and liver microsomal stability, along with low hERG toxicity [1].</p>Formule :C94H136FN21O25Couleur et forme :SolidMasse moléculaire :1979.21Peptide C105Y TFA
<p>Peptide C105Y TFA is a cell-penetrating peptide synthesized based on the amino acid sequence of residues 359-374 of α1-antitrypsin. It enhances the gene expression of DNA nanoparticles.</p>Formule :C97H148N20O23S·xC2HF3O2Orforglipron hemicalcium hydrate
CAS :<p>Orforglipron hemicalcium hydrate (LY3502970 hemicalcium hydrate; GLP-1 receptor agonist 1 hemicalcium hydrate) represents the hemicalcium hydrate form of the calcium salt of Orforglipron, an orally active agonist targeting the Glucagon-like peptide-1 receptor (GLP-1R). This compound has demonstrated efficacy in mitigating type 2 diabetes [1].</p>Formule :C48H48F2N10O5Ca·H2OCouleur et forme :SolidMasse moléculaire :921.02Secretin (33-59), rat TFA
<p>Secretin (33-59), rat (TFA), a 27-aa peptide, stimulates the secretin receptor, increasing pancreas secretion of bicarbonate, enzymes, and K+.</p>Formule :C131H217F3N42O44Couleur et forme :SolidMasse moléculaire :3141.37Ecnoglutide
CAS :<p>Ecnoglutide (XW003) is a glucagon-like peptide 1 (GLP-1) receptor agonist [1] .</p>Formule :C194H304N48O61Couleur et forme :SolidMasse moléculaire :4284.76GLP-1R/GIPR agonist-1
<p>GLP-1R/GIPR agonist-1 is a dual receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide). It mimics the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while suppressing glucagon release, thus lowering blood sugar. This compound is used in research related to metabolic disorders such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH).</p>Formule :C220H342N55O69Masse moléculaire :4858.49434GLP-1 receptor agonist 9 citrate
<p>GLP-1 receptor agonist 9 citrate is an agonist of GLP-1.</p>Formule :C38H39ClFN3O12Degré de pureté :98.76%Couleur et forme :SolidMasse moléculaire :784.18GLP-1 (9-36) amide
CAS :<p>GLP-1 (9-36) amide is an antagonist at the human GLP-1 receptor.</p>Formule :C140H214N36O43Degré de pureté :97%Couleur et forme :SolidMasse moléculaire :3089.41GLP-1(28-36)amide TFA
<p>GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.</p>Formule :C56H86F3N15O11Couleur et forme :SolidMasse moléculaire :1202.37GLP-1(9-36)amide TFA
<p>GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.</p>Formule :C142H215F3N36O45Couleur et forme :SolidMasse moléculaire :3203.43Anti-GLP1R Antibody
<p>Anti-GLP1R Antibody is a human antibody expressed in CHO cells, targeting GLP1R. For isotype controls, refer to Human IgG1 kappa, Isotype Control.</p>Couleur et forme :Odour LiquidUtreglutide
CAS :<p>Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .</p>Formule :C191H298N46O58Couleur et forme :SolidMasse moléculaire :4166.67Bay 55-9837 TFA
<p>Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.</p>Formule :C150H240F3ClN44O44Couleur et forme :SolidMasse moléculaire :3456.22Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide
<p>Biotin-labeled GLP-1-(7-36) amide; a gut peptide that enhances insulin release.</p>Formule :C165H252N44O48SCouleur et forme :SolidMasse moléculaire :3652.1Tirzepatide TFA
<p>Tirzepatide TFA, a GIP and GLP-1 agonist, targets type 2 diabetes treatment.</p>Formule :C227H349F3N48O70Couleur et forme :SolidMasse moléculaire :4927.47Exendin-4 (3-39)
CAS :<p>Exendin-4 (3-39) is a truncated peptide missing first 2 amino acids of Exendin-4, a potent GLP-1r agonist used in diabetes and HPA axis research.</p>Formule :C176H272N46O58SCouleur et forme :SolidMasse moléculaire :3992.44Glucagon-like peptide 1 (1-37), human
CAS :<p>Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.</p>Formule :C186H275N51O59Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4169.48Secretin (28-54), human
CAS :<p>Secretin (28-54), human, is a 27-amino acid residue peptide with a C-terminal amidation, acting on human secretin receptors.</p>Formule :C130H220N44O40Degré de pureté :98%Couleur et forme :PowderMasse moléculaire :3039.46Albenatide
CAS :<p>Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.</p>Formule :C26H47N7O9SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :633.76HAEGTFTSDVS
CAS :<p>HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.</p>Formule :C48H71N13O20Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1150.18Pal-Glu(OSu)-OH
CAS :<p>Pal-Glu(OSu)-OH is a Liraglutide side chain, a GLP-1 agonist for type 2 diabetes study.</p>Formule :C25H42N2O7Couleur et forme :SolidMasse moléculaire :482.618TT-OAD2
CAS :<p>TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.</p>Formule :C50H49Cl4N3O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :929.75GLP-2(1-33)(human)
CAS :<p>GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.</p>Formule :C165H254N44O55SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3766.19HAEGTFT
CAS :<p>HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.</p>Formule :C33H47N9O12Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :761.78GLP-1(7-36), amide acetate
CAS :<p>GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.</p>Formule :C151H230N40O47Degré de pureté :99.89%Couleur et forme :SolidMasse moléculaire :3357.68Apraglutide
CAS :<p>Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.</p>Formule :C172H263N43O52Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3765.25Dulaglutide
CAS :<p>Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).</p>Couleur et forme :SolidTaspoglutide
CAS :<p>Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetes</p>Formule :C152H232N40O45Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3339.763LSN3160440
CAS :<p>LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.</p>Formule :C27H27Cl2N3OCouleur et forme :SolidMasse moléculaire :480.43Des His1, Glu8 Exendin-4
<p>Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.</p>Formule :C179H277N47O59SDegré de pureté :99.92%Couleur et forme :SolidMasse moléculaire :4063.46Secretin, porcine
CAS :<p>Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.</p>Formule :C130H220N44O41·xC2H4O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :N/ATT-OAD2 free base
CAS :<p>TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.</p>Formule :C50H47Cl2N3O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :856.83{Val1}-Exendin-3/4
<p>{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.</p>Formule :NADegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3241.7GLP-1R agonist 14
CAS :<p>GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].</p>Formule :C45H42F2N10O5Couleur et forme :SolidMasse moléculaire :840.88GIP/GLP-1 dual receptor agonist-1
CAS :<p>Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.</p>Couleur et forme :SolidHAEGTFTSDVS acetate
<p>HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.</p>Formule :C50H75N13O22Degré de pureté :97.47%Couleur et forme :SolidMasse moléculaire :1210.2GLP-1R agonist 29
<p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>Couleur et forme :Odour SolidExendin-3/4 (59-86)
<p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>Formule :NADegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3055.49GLP-1(7-37)
CAS :<p>GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.</p>Formule :C151H228N40O47Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3355.67Mazdutide acetate(2259884-03-0 free base)
<p>Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.</p>Degré de pureté :98.41%Couleur et forme :Odour SolidBay 55-9837
CAS :<p>Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.</p>Formule :C167H270N52O46Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3742.29Semaglutide TFA
<p>Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patients</p>Formule :C189H290F3N45O61Degré de pureté :99.69%Couleur et forme :SolidMasse moléculaire :4225.6482Survodutide
CAS :<p>Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.</p>Formule :C192H289N47O61Degré de pureté :99.83%Couleur et forme :SolidMasse moléculaire :4229.0957VU0453379 hydrochloride
<p>VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.</p>Formule :C26H35ClN4O2Couleur et forme :SolidMasse moléculaire :471.033-Deoxyglucosone
CAS :<p>3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with protein</p>Formule :C6H10O5Degré de pureté :95%Couleur et forme :SolidMasse moléculaire :162.14Sorbinicate
CAS :<p>Sorbinicate is an antihypercholesterolaemic and vasodilating nicotinic acid ester.</p>Formule :C42H32N6O12Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :812.74Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Formule :C148H224N40O45·xC2HF3O2Couleur et forme :Solid(R)-V-0219 hydrochloride
<p>(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.</p>Formule :C20H26ClF3N4O2Couleur et forme :SolidMasse moléculaire :446.89Maridebart
CAS :<p>Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].</p>Couleur et forme :LiquidOxyntomodulin
CAS :<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Formule :C192H295N59O60SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4421.86GLP-1 receptor agonist 8
CAS :<p>GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.</p>Formule :C34H36ClFN6O4Couleur et forme :SolidMasse moléculaire :647.14[Des-His1,Glu9]-Glucagon amide
CAS :<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Formule :C148H221N41O47SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3358.68GLP-1R agonist 27
<p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>Formule :C32H33N5O4SeCouleur et forme :SolidMasse moléculaire :630.6(S)-V-0219 hydrochloride
<p>(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.</p>Formule :C20H26ClF3N4O2Couleur et forme :SolidMasse moléculaire :446.89GLP-1R agonist 15
CAS :<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Formule :C46H47FN8O7SCouleur et forme :SolidMasse moléculaire :874.98Gulgafafusp alfa
CAS :<p>Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].</p>Couleur et forme :LiquidAnti-GLP-1R Antibody
<p>Anti-GLP-1R Antibody is an anti-GLP-1R antibody that can be used for immunohistochemistry of paraffin sections.</p>Degré de pureté :98.3% (SDS-PAGE); 97.2% (SEC-HPLC) - 98.3% (SDS-PAGE); 97.2% (SEC-HPLC)Couleur et forme :Odour LiquidSPN009
<p>SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.</p>Formule :C191H299N45O59Masse moléculaire :4167.17798Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Formule :C188H276N51F3O61Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4283.5GLP-1R agonist 20
<p>GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.</p>Formule :C31H30Cl2F2N4O5Masse moléculaire :646.15613GLP-1R agonist 16
CAS :<p>Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].</p>Formule :C50H58FN10O6PCouleur et forme :SolidMasse moléculaire :945.03GLP-1R agonist 4
CAS :<p>GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.</p>Formule :C32H30ClF2N3O5Couleur et forme :SolidMasse moléculaire :610.05SAR441255
<p>SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptors</p>Couleur et forme :Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Couleur et forme :SolidMasse moléculaire :3692.15Dapiglutide
CAS :<p>Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.</p>Couleur et forme :SolidGRPP (human)
CAS :<p>GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.</p>Formule :C136H215N41O58SCouleur et forme :SolidMasse moléculaire :3384.47Glucagon (1-29), bovine, human, porcine
CAS :<p>Corynoxine B (Cory B) is a naturally occurring alkaloid isolated from Uncaria rhynchophylla (Miq. ) and is an autophagy inducer.</p>Formule :C153H225N43O49SDegré de pureté :99.56% - 99.56%Couleur et forme :SolidMasse moléculaire :3482.75GLP-1 receptor agonist 7
CAS :<p>GLP-1 receptor agonist 7, potential for diabetes research, from patent WO2021219019A1.</p>Formule :C31H30ClFN4O5Couleur et forme :SolidMasse moléculaire :593.05GLP-1 receptor agonist 2
CAS :<p>GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Formule :C30H31ClFN5O4Couleur et forme :SolidMasse moléculaire :580.05V-0219
CAS :<p>V-0219 is a positive allosteric modulator of GLP-1 and can be used in studies about obesity-associated diabetes.</p>Formule :C20H25F3N4O2Degré de pureté :99.91%Couleur et forme :SoildMasse moléculaire :410.43GLP-1R modulator C16
CAS :<p>GLP-1R modulator C16 is a variable modulator that significantly increases the binding affinity of GLP-4.</p>Formule :C21H26ClFN2O3Degré de pureté :99.6% - >99.99%Couleur et forme :SolidMasse moléculaire :408.89

