Récepteur du glucagon
Les récepteurs du glucagon sont des GPCR qui médiatisent les effets du glucagon, une hormone impliquée dans la régulation de l'homéostasie du glucose en favorisant la dégradation du glycogène et la libération de glucose par le foie. Ces récepteurs sont essentiels dans la gestion des niveaux de sucre dans le sang et sont particulièrement intéressants dans l'étude du diabète et des troubles métaboliques. Les antagonistes des récepteurs du glucagon sont explorés comme traitements potentiels de l'hyperglycémie dans le diabète de type 2. Chez CymitQuimica, nous offrons une variété de modulateurs de récepteurs du glucagon de haute qualité pour soutenir vos recherches en endocrinologie, diabète et régulation métabolique.
192 produits trouvés pour "Récepteur du glucagon"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
PF-06882961
CAS :PF-06882961 is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.Formule :C31H30FN5O4Degré de pureté :97.19% - 99.56%Couleur et forme :SolidMasse moléculaire :555.6Glucagon (1-29), bovine, human, porcine hydrochloride
CAS :Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon increases HNF4α phosphorylation.Formule :C153H225N43O49S·ClHDegré de pureté :95.65% - 98.03%Couleur et forme :SolidMasse moléculaire :3519.21Ref: TM-T15389L
1mg66,00€5mg173,00€10mg260,00€25mg449,00€50mg657,00€100mg887,00€200mg1.198,00€250mg1.368,00€Retatrutide
CAS :Retatrutide (LY3437943) is a triple agonist of GCGR, GIPR and GLP-1R that can be used to study obesity.Formule :C221H342N46O68Degré de pureté :98.31%Couleur et forme :SolidMasse moléculaire :4732.09Avexitide acetate
CAS :Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.Formule :C155H246N40O53SDegré de pureté :96.64% - 98.65%Couleur et forme :SolidMasse moléculaire :3549.91Tirzepatide monosodium salt
Tirzepatide sodium salt (LY3298176 sodium salt) is a GIP and GLP-1 receptor agonist with neuroprotective activity and can be used to treat obesity.Formule :C225H347N48O68NaDegré de pureté :99.69%Couleur et forme :SoildMasse moléculaire :4835.51Retatrutide sodium salt
Retatrutide sodium salt is a glucagon receptor and glucagon-like peptide-1 receptor agonist for the study of type 2 diabetes mellitus.Degré de pureté :99.97%Couleur et forme :SoildOrforglipron
CAS :Orforglipron (LY3502970; GLP-1 receptor agonist 1) is an orally available glucagon-like peptide (GLP-1) receptor agonist for the study of obesity and type 1Formule :C48H48F2N10O5Degré de pureté :99.47% - 99.8%Couleur et forme :SolidMasse moléculaire :882.96[Gly8]-GLP-1(7-37) acetate
[Gly8]-GLP-1(7-37) acetate is a derivative of GLP-1, where glycine at position 8 is replaced with alanine. [Gly8]-GLP-1(7-37) acetate is also a peptide fragment of the GLP-1 receptor (GLP-1R) agonist, Dulaglutide.Couleur et forme :Odour SolidGLP-1R agonist 34
CAS :GLP-1R agonist 34 (Compound 1) is an orally active small molecule agonist of the glucagon-like peptide-1 receptor (GLP-1R). It enhances insulin secretion, suppresses glucagon release, and slows gastric emptying, thereby effectively reducing blood glucose levels. GLP-1R agonist 34 holds potential for research into metabolic disorders such as type 2 diabetes, obesity, and non-alcoholic steatohepatitis (NASH).Formule :C50H50F2N10O5Couleur et forme :SolidMasse moléculaire :908.99Berobenatide
CAS :Berobenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist.Couleur et forme :SolidGLP-1R Agonist DMB
CAS :GLP-1R Agonist DMB is an agonist of glucagon-like peptide 1 receptor (GLP-1R; KB = 26.3 nM for the recombinant human receptor).Formule :C13H15Cl2N3O2SDegré de pureté :99.52%Couleur et forme :SolidMasse moléculaire :348.25GLP-1R Antagonist 1
CAS :GLP-1R Antagonist 1 is an orally active, CNS penetrant and non-competitive glucagon-like peptide 1 receptor (GLP-1R) antagonist (IC50: 650 nM).Formule :C16H11ClF6N4O2Degré de pureté :99.84%Couleur et forme :SolidMasse moléculaire :440.73HAEGTFTSD
CAS :HAEGTFTSD is GLP-1's initial segment; GLP-1 (7-36) amide, tied to food intake, stems from preproglucagon in L-cells.Formule :C40H57N11O17Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :963.94Tirzepatide
CAS :Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.Formule :C225H348N48O68Degré de pureté :99.52% - 99.99%Couleur et forme :SolidMasse moléculaire :4813.45HAEGT
CAS :HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.
Formule :C20H31N7O9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :513.5Glucagon receptor antagonists-1
CAS :Glucagon receptor antagonist -1 is a highly effective glucagon receptor antagonist.Formule :C29H34FNO2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :447.58V-0219 hydrochloride
V-0219 hydrochloride: oral GLP-1R PAM for obesity-linked diabetes study.
Formule :C20H26ClF3N4O2Degré de pureté :99.97%Couleur et forme :SoildMasse moléculaire :446.89GLP-1 moiety from Dulaglutide
GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.Formule :C149H221N37O49Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3314.62HAEGTFTSD acetate(926018-45-3 free base)
HAEGTFTSD acetate is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted fromFormule :C42H61N11O19Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1024.01GLP-1 receptor agonist 13
Compound (S)-9, a GLP-1 receptor agonist, exhibits an EC50 of 76 nM for the glucagon GLP-1 receptor [1].Formule :C25H23ClF2N6OCouleur et forme :SolidMasse moléculaire :496.94Albiglutide Fragment
CAS :Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).Formule :C148H224N40O45Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3283.66α-Methylprednisolone 21-hemisuccinate sodium salt
CAS :6α-Methylprednisolone 21-hemisuccinate sodium salt (Asmacortone), a water-soluble ester, is used for allergic, cardiac, and hypoxic emergencies.Formule :C26H33NaO8Degré de pureté :99.65%Couleur et forme :Lyophilized PowderMasse moléculaire :496.53Cinnamtannin A2
CAS :Cinnamtannin A2, a tetrameric procyanidin, boosts GLP-1, insulin, CRH expression, and has antioxidant, anti-diabetic, nephroprotective properties.
Formule :C60H50O24Couleur et forme :SolidMasse moléculaire :1155.02Tirzepatide hydrochloride
Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.Formule :C225H349N48O68ClDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4849.91Survodutide TFA
Survodutide TFA (BI 456906 TFA) is a GCGR/GLP-1R dual agonist, a peptide compound used in obesity research.Formule :C192H289N47O61·xC2HF3OC2Degré de pureté :99.29% - 99.96%Couleur et forme :SolidMasse moléculaire :4231.62 (free base)Secretin (28-54), human TFA
Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.Formule :C132H221N44F3O42Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3153.48VU0453379
CAS :VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).Formule :C26H34N4O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :434.57GLP-1 receptor agonist 4
CAS :GLP-1 receptor agonist 4 targets GLP-1R, EC50 64.5 nM, potential diabetes treatment research.Formule :C51H44Cl2N4O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :879.82Glucagon (19-29), human
CAS :Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.Formule :C61H89N15O18SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1352.53GIP/GLP-1 dual receptor agonist-1 sodium
GIP/GLP-1 dual receptor agonist-1 (Compound 4) (sodium) functions as a GIP/GLP-1 receptor agonist. This compound is applicable for research into metabolic disorders and liver diseases, including non-alcoholic steatohepatitis (NASH) and non-alcoholic fatty liver disease (NAFLD).Couleur et forme :Odour SolidSecretin, canine TFA
Secretin, canine TFA, is an endocrine hormone that stimulates the secretion of pancreatic fluid rich in bicarbonate. Additionally, Secretin, canine TFA, can regulate the primary cell functions and paracellular permeability of gastric monolayer cells through an Src kinase-dependent pathway.Couleur et forme :Odour SolidGlucagon Receptor Antagonist Inactive Control
CAS :Glucagon Receptor Antagonist Inactive Control is a Glucagon receptor antagonist that can be used in related research in the field of life sciences.Formule :C21H23BrN2OSCouleur et forme :SolidMasse moléculaire :431.39TE-8105
TE-8105 is a GLP-1 receptor agonist that demonstrates prolonged and enhanced efficacy in models of diabetes, obesity, and non-alcoholic steatohepatitis (NASH).Couleur et forme :Odour SolidZovaglutide
CAS :Zovaglutide is a GLP-1 receptor agonist that is utilized in diabetes research.Couleur et forme :SolidGTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Couleur et forme :SolidMasse moléculaire :3850.31WB4-24
CAS :WB4-24 is a GLP-1 receptor agonist that enhances the release of β-endorphin in microglia. It exhibits antiallodynic, anti-inflammatory, and analgesic effects in mouse models of inflammation induced by formalin, carrageenan, and CFA.Formule :C52H48N4O14S2Couleur et forme :SolidMasse moléculaire :1017.09Peptide C105Y TFA
Peptide C105Y TFA is a cell-penetrating peptide synthesized based on the amino acid sequence of residues 359-374 of α1-antitrypsin. It enhances the gene expression of DNA nanoparticles.Formule :C97H148N20O23S·xC2HF3O2GLP-1R agonist 20
GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.Formule :C31H30Cl2F2N4O5Masse moléculaire :646.15613SPN009
SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.Formule :C191H299N45O59Masse moléculaire :4167.17798Pemvidutide TFA
Pemvidutide (TFA), a GLP-1R/GCGR dual agonist, effectively reduces body weight, liver fat, and serum lipid levels, and is utilized in research on non-alcoholicFormule :C182H275N39O54·xC2HF3O2Couleur et forme :SolidMasse moléculaire :3873.35 (free base)Sorbinicate
CAS :Sorbinicate is an antihypercholesterolaemic and vasodilating nicotinic acid ester.Formule :C42H32N6O12Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :812.74Semaglutide, FITC labeled
Semaglutide (FITC-labeled Semaglutide) is a long-acting analog of human glucagon-like peptide-1, functioning as an agonist of the GLP-1 receptor. It shows potential for research related to type 2 diabetes.Formule :C209H304N46O63SMasse moléculaire :4498.17191SDV-Exendin-3/4
SDV-Exendin-3/4 is a 32-amino acid peptide.Formule :NADegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3443.87Acmopatide
CAS :Acmopatide (Compound E-153) is a dual agonist of GIP and GLP-1 receptors and can be utilized in diabetes research.Couleur et forme :SolidGlucagon-like peptide 1 (1-37), human
CAS :Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.Formule :C186H275N51O59Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4169.48Secretin (28-54), human
CAS :Secretin (28-54), human, is a 27-amino acid residue peptide with a C-terminal amidation, acting on human secretin receptors.Formule :C130H220N44O40Degré de pureté :98%Couleur et forme :PowderMasse moléculaire :3039.46Albenatide
CAS :Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.
Formule :C26H47N7O9SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :633.76HAEGTFTSDVS
CAS :HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.Formule :C48H71N13O20Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1150.18Pal-Glu(OSu)-OH
CAS :Pal-Glu(OSu)-OH is a Liraglutide side chain, a GLP-1 agonist for type 2 diabetes study.Formule :C25H42N2O7Couleur et forme :SolidMasse moléculaire :482.618TT-OAD2
CAS :TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.
Formule :C50H49Cl4N3O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :929.75GLP-2(1-33)(human)
CAS :GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.Formule :C165H254N44O55SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3766.19HAEGTFT
CAS :HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.Formule :C33H47N9O12Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :761.78GLP-1(7-36), amide acetate
CAS :GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.Formule :C151H230N40O47Degré de pureté :99.89%Couleur et forme :SolidMasse moléculaire :3357.68Apraglutide
CAS :Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.Formule :C172H263N43O52Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3765.25Dulaglutide
CAS :Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).Couleur et forme :SolidTaspoglutide
CAS :Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetesFormule :C152H232N40O45Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3339.763LSN3160440
CAS :LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.Formule :C27H27Cl2N3OCouleur et forme :SolidMasse moléculaire :480.43Des His1, Glu8 Exendin-4
Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.Formule :C179H277N47O59SDegré de pureté :99.92%Couleur et forme :SolidMasse moléculaire :4063.46Secretin, porcine
CAS :Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.Formule :C130H220N44O41·xC2H4O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :N/ATT-OAD2 free base
CAS :TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.Formule :C50H47Cl2N3O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :856.83Maridebart
CAS :Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].Couleur et forme :Liquid{Val1}-Exendin-3/4
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.Formule :NADegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3241.7GLP-1R agonist 14
CAS :GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].Formule :C45H42F2N10O5Couleur et forme :SolidMasse moléculaire :840.88GIP/GLP-1 dual receptor agonist-1
CAS :Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.Couleur et forme :SolidHAEGTFTSDVS acetate
HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.Formule :C50H75N13O22Degré de pureté :97.47%Couleur et forme :SolidMasse moléculaire :1210.2GLP-1R agonist 29
GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.Couleur et forme :Odour SolidExendin-3/4 (59-86)
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.Formule :NADegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3055.49GLP-1(7-37)
CAS :GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.Formule :C151H228N40O47Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3355.67Bay 55-9837
CAS :Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.Formule :C167H270N52O46Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3742.29Mazdutide acetate(2259884-03-0 free base)
Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.Degré de pureté :98.41%Couleur et forme :Odour SolidSemaglutide TFA
Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patientsFormule :C189H290F3N45O61Degré de pureté :99.69% - 99.94%Couleur et forme :SolidMasse moléculaire :4225.6482VU0453379 hydrochloride
VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.Formule :C26H35ClN4O2Couleur et forme :SolidMasse moléculaire :471.03Survodutide
CAS :Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.Formule :C192H289N47O61Degré de pureté :99.83%Couleur et forme :SolidMasse moléculaire :4229.09573-Deoxyglucosone
CAS :3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with proteinFormule :C6H10O5Degré de pureté :95%Couleur et forme :SolidMasse moléculaire :162.14Albiglutide fragment TFA
Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as aFormule :C148H224N40O45·xC2HF3O2Couleur et forme :SolidRibupatide
CAS :Ribupatide is a dual agonist of gastric inhibitory polypeptide (GIP) and glucagon-like peptide 1 (GLP-1) receptors and can be utilized in antidiabetic research.Couleur et forme :Solid(R)-V-0219 hydrochloride
(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.Formule :C20H26ClF3N4O2Couleur et forme :SolidMasse moléculaire :446.89Vensemaglutide
CAS :Vensemaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in research related to diabetes or other metabolic disorders.Formule :C214H337N49O67Masse moléculaire :4668.25Oxyntomodulin
CAS :GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.Formule :C192H295N59O60SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4421.86GLP-1 receptor agonist 8
CAS :GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.Formule :C34H36ClFN6O4Couleur et forme :SolidMasse moléculaire :647.14[Des-His1,Glu9]-Glucagon amide
CAS :Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.Formule :C148H221N41O47SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3358.68GLP-1R agonist 27
GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).Formule :C32H33N5O4SeCouleur et forme :SolidMasse moléculaire :630.6GLP-1R agonist 26
CAS :Compound 1, also known as GLP-1R agonist 26, is an agonist of the glucagon-like peptide-1 receptor (GLP-1R) with an EC50 of <10 nM.Formule :C32H29FN6O4SCouleur et forme :SolidMasse moléculaire :612.67(S)-V-0219 hydrochloride
(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.Formule :C20H26ClF3N4O2Couleur et forme :SolidMasse moléculaire :446.89GLP-1R agonist 15
CAS :GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .Formule :C46H47FN8O7SCouleur et forme :SolidMasse moléculaire :874.98Liraglutide acetate
CAS :Liraglutide acetate is the acetate salt form of Liraglutide, which is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in the study of type 2 diabetes.Formule :C172H265N43O51·xC2H4O2Couleur et forme :SolidMasse moléculaire :3751.20 (free base)PHI-27 (porcine)
CAS :PHI-27 (porcine) is a porcine-derived peptide consisting of 27 amino acids, utilized in the identification of peptide hormones and other bioactive peptides [1].Formule :C136H216N36O40Couleur et forme :SolidMasse moléculaire :2995.39Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Formule :C188H276N51F3O61Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4283.5DD202-114
CAS :DD202-114 is an effective and selective agonist of GLP1R. It promotes the accumulation of cAMP, reduces blood glucose levels, and decreases food intake. Additionally, DD202-114 holds potential for research in type 2 diabetes mellitus (T2DM) and obesity studies.Formule :C33H35FN4O5Couleur et forme :SolidMasse moléculaire :586.65GLP-1R agonist 16
CAS :Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].Formule :C50H58FN10O6PCouleur et forme :SolidMasse moléculaire :945.03GLP-1R agonist 4
CAS :GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.Formule :C32H30ClF2N3O5Couleur et forme :SolidMasse moléculaire :610.05SAR441255
SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptorsCouleur et forme :Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Couleur et forme :SolidMasse moléculaire :3692.15Dapiglutide
CAS :Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.Couleur et forme :SolidGRPP (human)
CAS :GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.Formule :C136H215N41O58SCouleur et forme :SolidMasse moléculaire :3384.47GLP-1(28-36)amide TFA
GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.Formule :C56H86F3N15O11Couleur et forme :SolidMasse moléculaire :1202.37GLP-1(9-36)amide TFA
GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.Formule :C142H215F3N36O45Couleur et forme :SolidMasse moléculaire :3203.43(Asp28)-Glucagon (1-29) (human, rat, porcine)
CAS :"(Asp28)-Glucagon (1-29) (human, rat, porcine)" is an analog of glucagon with an aspartic acid (Asp) substitution at position 28, notably enhancing its aqueousFormule :C153H224N42O50SCouleur et forme :SolidMasse moléculaire :3483.73Utreglutide
CAS :Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .Formule :C191H298N46O58Couleur et forme :SolidMasse moléculaire :4166.67Bay 55-9837 TFA
Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.Formule :C150H240F3ClN44O44Couleur et forme :SolidMasse moléculaire :3456.22
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
