CymitQuimica logo
Récepteur du glucagon

Récepteur du glucagon

Les récepteurs du glucagon sont des GPCR qui médiatisent les effets du glucagon, une hormone impliquée dans la régulation de l'homéostasie du glucose en favorisant la dégradation du glycogène et la libération de glucose par le foie. Ces récepteurs sont essentiels dans la gestion des niveaux de sucre dans le sang et sont particulièrement intéressants dans l'étude du diabète et des troubles métaboliques. Les antagonistes des récepteurs du glucagon sont explorés comme traitements potentiels de l'hyperglycémie dans le diabète de type 2. Chez CymitQuimica, nous offrons une variété de modulateurs de récepteurs du glucagon de haute qualité pour soutenir vos recherches en endocrinologie, diabète et régulation métabolique.

164 produits trouvés pour "Récepteur du glucagon"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
  • Crotedumab

    CAS :
    <p>Crotedumab (REGN1193) is a humanized antibody targeting GCGR, which reduces fasting blood glucose and improves glucose tolerance, used in diabetes research.</p>
    Degré de pureté :>95%
    Couleur et forme :Liquid
  • Volagidemab

    CAS :
    <p>Anti-CD34 Antibody is a CHO-expressed humanized monoclonal antibody targeting CD34, which can be used for the study of neurological and cardiovascular diseases.</p>
    Degré de pureté :97.8% (SDS-PAGE); 98% (SEC-HPLC) - 97.8% (SDS-PAGE); 98% (SEC-HPLC)
    Couleur et forme :Liquid
  • Glucagon (1-29), bovine, human, porcine hydrochloride

    CAS :
    <p>Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon increases HNF4α phosphorylation.</p>
    Formule :C153H225N43O49S·ClH
    Degré de pureté :95.65% - 98.03%
    Couleur et forme :Solid
    Masse moléculaire :3519.21
  • Retatrutide sodium salt


    <p>Retatrutide sodium salt is a glucagon receptor and glucagon-like peptide-1 receptor agonist for the study of type 2 diabetes mellitus.</p>
    Degré de pureté :99.97%
    Couleur et forme :Soild
  • PF-06882961

    CAS :
    <p>PF-06882961 is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>
    Formule :C31H30FN5O4
    Degré de pureté :98.06% - 99.54%
    Couleur et forme :Solid
    Masse moléculaire :555.6
  • Tirzepatide monosodium salt


    <p>Tirzepatide sodium salt (LY3298176 sodium salt) is a GIP and GLP-1 receptor agonist with neuroprotective activity and can be used to treat obesity.</p>
    Formule :C225H347N48O68Na
    Degré de pureté :99.69%
    Couleur et forme :Soild
    Masse moléculaire :4835.51
  • Retatrutide

    CAS :
    <p>Retatrutide (LY3437943) is a triple agonist of GCGR, GIPR and GLP-1R that can be used to study obesity.</p>
    Formule :C221H342N46O68
    Degré de pureté :98.31%
    Couleur et forme :Solid
    Masse moléculaire :4732.09
  • Avexitide acetate

    CAS :
    <p>Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.</p>
    Formule :C155H246N40O53S
    Degré de pureté :96.64% - 98.65%
    Couleur et forme :Solid
    Masse moléculaire :3549.91
  • (S, R)-LSN 3318839

    CAS :
    <p>(S,R)-LSN 3318839 enhances GLP-1R, shows strong blood sugar lowering in animals, works with sitagliptin.</p>
    Formule :C26H23Cl2N3O2
    Degré de pureté :99.57%
    Couleur et forme :Soild
    Masse moléculaire :480.39
  • GLP-1R Agonist DMB

    CAS :
    <p>GLP-1R Agonist DMB is an agonist of glucagon-like peptide 1 receptor (GLP-1R; KB = 26.3 nM for the recombinant human receptor).</p>
    Formule :C13H15Cl2N3O2S
    Degré de pureté :99.52%
    Couleur et forme :Solid
    Masse moléculaire :348.25
  • GLP-1R Antagonist 1

    CAS :
    <p>GLP-1R Antagonist 1 is an orally active, CNS penetrant and non-competitive glucagon-like peptide 1 receptor (GLP-1R) antagonist (IC50: 650 nM).</p>
    Formule :C16H11ClF6N4O2
    Degré de pureté :99.84%
    Couleur et forme :Solid
    Masse moléculaire :440.73
  • HAEGTFTSD

    CAS :
    <p>HAEGTFTSD is GLP-1's initial segment; GLP-1 (7-36) amide, tied to food intake, stems from preproglucagon in L-cells.</p>
    Formule :C40H57N11O17
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :963.94
  • Tirzepatide

    CAS :
    <p>Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.</p>
    Formule :C225H348N48O68
    Degré de pureté :99.52% - 99.99%
    Couleur et forme :Solid
    Masse moléculaire :4813.45
  • HAEGT

    CAS :
    <p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>
    Formule :C20H31N7O9
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :513.5
  • Glucagon receptor antagonists-1

    CAS :
    <p>Glucagon receptor antagonist -1 is a highly effective glucagon receptor antagonist.</p>
    Formule :C29H34FNO2
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :447.58
  • V-0219 hydrochloride


    <p>V-0219 hydrochloride: oral GLP-1R PAM for obesity-linked diabetes study.</p>
    Formule :C20H26ClF3N4O2
    Degré de pureté :99.97%
    Couleur et forme :Soild
    Masse moléculaire :446.89
  • Orforglipron

    CAS :
    <p>Orforglipron (LY3502970; GLP-1 receptor agonist 1) is an orally available glucagon-like peptide (GLP-1) receptor agonist for the study of obesity and type 1</p>
    Formule :C48H48F2N10O5
    Degré de pureté :99.47% - 99.8%
    Couleur et forme :Solid
    Masse moléculaire :882.96
  • GLP-1 moiety from Dulaglutide


    <p>GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.</p>
    Formule :C149H221N37O49
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3314.62
  • HAEGTFTSD acetate(926018-45-3 free base)


    <p>HAEGTFTSD acetate is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted from</p>
    Formule :C42H61N11O19
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :1024.01
  • GLP-1 receptor agonist 13


    <p>Compound (S)-9, a GLP-1 receptor agonist, exhibits an EC50 of 76 nM for the glucagon GLP-1 receptor [1].</p>
    Formule :C25H23ClF2N6O
    Couleur et forme :Solid
    Masse moléculaire :496.94
  • Albiglutide Fragment

    CAS :
    <p>Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).</p>
    Formule :C148H224N40O45
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3283.6
  • 6α-Methylprednisolone 21-hemisuccinate sodium salt

    CAS :
    <p>6α-Methylprednisolone 21-hemisuccinate sodium salt (Asmacortone), a water-soluble ester, is used for allergic, cardiac, and hypoxic emergencies.</p>
    Formule :C26H33NaO8
    Degré de pureté :99.65%
    Couleur et forme :Lyophilized Powder
    Masse moléculaire :496.53
  • Cinnamtannin A2

    CAS :
    <p>Cinnamtannin A2, a tetrameric procyanidin, boosts GLP-1, insulin, CRH expression, and has antioxidant, anti-diabetic, nephroprotective properties.</p>
    Formule :C60H50O24
    Couleur et forme :Solid
    Masse moléculaire :1155.02
  • Tirzepatide hydrochloride


    <p>Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.</p>
    Formule :C225H349N48O68Cl
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :4849.91
  • Survodutide TFA


    <p>Survodutide TFA (BI 456906 TFA) is a GCGR/GLP-1R dual agonist, a peptide compound used in obesity research.</p>
    Formule :C192H289N47O61·xC2HF3OC2
    Degré de pureté :99.29% - 99.96%
    Couleur et forme :Solid
    Masse moléculaire :4231.62 (free base)
  • Secretin (28-54), human TFA


    <p>Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.</p>
    Formule :C132H221N44F3O42
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3153.48
  • VU0453379

    CAS :
    <p>VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).</p>
    Formule :C26H34N4O2
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :434.57
  • GLP-1 receptor agonist 4

    CAS :
    <p>GLP-1 receptor agonist 4 targets GLP-1R, EC50 64.5 nM, potential diabetes treatment research.</p>
    Formule :C51H44Cl2N4O6
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :879.82
  • Glucagon (19-29), human

    CAS :
    <p>Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.</p>
    Formule :C61H89N15O18S
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :1352.53
  • GLP-1R agonist 19

    CAS :
    <p>GLP-1R agonist 19 (M3190) is a potent, selective GLP-1 receptor agonist that demonstrates excellent plasma and liver microsomal stability, along with low hERG toxicity [1].</p>
    Formule :C94H136FN21O25
    Couleur et forme :Solid
    Masse moléculaire :1979.21
  • Peptide C105Y TFA


    <p>Peptide C105Y TFA is a cell-penetrating peptide synthesized based on the amino acid sequence of residues 359-374 of α1-antitrypsin. It enhances the gene expression of DNA nanoparticles.</p>
    Formule :C97H148N20O23S·xC2HF3O2
  • Orforglipron hemicalcium hydrate

    CAS :
    <p>Orforglipron hemicalcium hydrate (LY3502970 hemicalcium hydrate; GLP-1 receptor agonist 1 hemicalcium hydrate) represents the hemicalcium hydrate form of the calcium salt of Orforglipron, an orally active agonist targeting the Glucagon-like peptide-1 receptor (GLP-1R). This compound has demonstrated efficacy in mitigating type 2 diabetes [1].</p>
    Formule :C48H48F2N10O5Ca·H2O
    Couleur et forme :Solid
    Masse moléculaire :921.02
  • Secretin (33-59), rat TFA


    <p>Secretin (33-59), rat (TFA), a 27-aa peptide, stimulates the secretin receptor, increasing pancreas secretion of bicarbonate, enzymes, and K+.</p>
    Formule :C131H217F3N42O44
    Couleur et forme :Solid
    Masse moléculaire :3141.37
  • Ecnoglutide

    CAS :
    <p>Ecnoglutide (XW003) is a glucagon-like peptide 1 (GLP-1) receptor agonist [1] .</p>
    Formule :C194H304N48O61
    Couleur et forme :Solid
    Masse moléculaire :4284.76
  • GLP-1R/GIPR agonist-1


    <p>GLP-1R/GIPR agonist-1 is a dual receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide). It mimics the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while suppressing glucagon release, thus lowering blood sugar. This compound is used in research related to metabolic disorders such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH).</p>
    Formule :C220H342N55O69
    Masse moléculaire :4858.49434
  • GLP-1 receptor agonist 9 citrate


    <p>GLP-1 receptor agonist 9 citrate is an agonist of GLP-1.</p>
    Formule :C38H39ClFN3O12
    Degré de pureté :98.76%
    Couleur et forme :Solid
    Masse moléculaire :784.18
  • GLP-1 (9-36) amide

    CAS :
    <p>GLP-1 (9-36) amide is an antagonist at the human GLP-1 receptor.</p>
    Formule :C140H214N36O43
    Degré de pureté :97%
    Couleur et forme :Solid
    Masse moléculaire :3089.41
  • GLP-1(28-36)amide TFA


    <p>GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.</p>
    Formule :C56H86F3N15O11
    Couleur et forme :Solid
    Masse moléculaire :1202.37
  • GLP-1(9-36)amide TFA


    <p>GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.</p>
    Formule :C142H215F3N36O45
    Couleur et forme :Solid
    Masse moléculaire :3203.43
  • Anti-GLP1R Antibody


    <p>Anti-GLP1R Antibody is a human antibody expressed in CHO cells, targeting GLP1R. For isotype controls, refer to Human IgG1 kappa, Isotype Control.</p>
    Couleur et forme :Odour Liquid
  • Utreglutide

    CAS :
    <p>Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .</p>
    Formule :C191H298N46O58
    Couleur et forme :Solid
    Masse moléculaire :4166.67
  • Bay 55-9837 TFA


    <p>Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.</p>
    Formule :C150H240F3ClN44O44
    Couleur et forme :Solid
    Masse moléculaire :3456.22
  • Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide


    <p>Biotin-labeled GLP-1-(7-36) amide; a gut peptide that enhances insulin release.</p>
    Formule :C165H252N44O48S
    Couleur et forme :Solid
    Masse moléculaire :3652.1
  • Tirzepatide TFA


    <p>Tirzepatide TFA, a GIP and GLP-1 agonist, targets type 2 diabetes treatment.</p>
    Formule :C227H349F3N48O70
    Couleur et forme :Solid
    Masse moléculaire :4927.47
  • Exendin-4 (3-39)

    CAS :
    <p>Exendin-4 (3-39) is a truncated peptide missing first 2 amino acids of Exendin-4, a potent GLP-1r agonist used in diabetes and HPA axis research.</p>
    Formule :C176H272N46O58S
    Couleur et forme :Solid
    Masse moléculaire :3992.44
  • Glucagon-like peptide 1 (1-37), human

    CAS :
    <p>Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.</p>
    Formule :C186H275N51O59
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :4169.48
  • Secretin (28-54), human

    CAS :
    <p>Secretin (28-54), human, is a 27-amino acid residue peptide with a C-terminal amidation, acting on human secretin receptors.</p>
    Formule :C130H220N44O40
    Degré de pureté :98%
    Couleur et forme :Powder
    Masse moléculaire :3039.46
  • Albenatide

    CAS :
    <p>Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.</p>
    Formule :C26H47N7O9S
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :633.76
  • HAEGTFTSDVS

    CAS :
    <p>HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.</p>
    Formule :C48H71N13O20
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :1150.18
  • Pal-Glu(OSu)-OH

    CAS :
    <p>Pal-Glu(OSu)-OH is a Liraglutide side chain, a GLP-1 agonist for type 2 diabetes study.</p>
    Formule :C25H42N2O7
    Couleur et forme :Solid
    Masse moléculaire :482.618
  • TT-OAD2

    CAS :
    <p>TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.</p>
    Formule :C50H49Cl4N3O6
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :929.75
  • GLP-2(1-33)(human)

    CAS :
    <p>GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.</p>
    Formule :C165H254N44O55S
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3766.19
  • HAEGTFT

    CAS :
    <p>HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.</p>
    Formule :C33H47N9O12
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :761.78
  • GLP-1(7-36), amide acetate

    CAS :
    <p>GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.</p>
    Formule :C151H230N40O47
    Degré de pureté :99.89%
    Couleur et forme :Solid
    Masse moléculaire :3357.68
  • Apraglutide

    CAS :
    <p>Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.</p>
    Formule :C172H263N43O52
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3765.25
  • Dulaglutide

    CAS :
    <p>Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).</p>
    Couleur et forme :Solid
  • Taspoglutide

    CAS :
    <p>Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetes</p>
    Formule :C152H232N40O45
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3339.763
  • LSN3160440

    CAS :
    <p>LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.</p>
    Formule :C27H27Cl2N3O
    Couleur et forme :Solid
    Masse moléculaire :480.43
  • Des His1, Glu8 Exendin-4


    <p>Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.</p>
    Formule :C179H277N47O59S
    Degré de pureté :99.92%
    Couleur et forme :Solid
    Masse moléculaire :4063.46
  • Secretin, porcine

    CAS :
    <p>Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.</p>
    Formule :C130H220N44O41·xC2H4O2
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :N/A
  • TT-OAD2 free base

    CAS :
    <p>TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.</p>
    Formule :C50H47Cl2N3O6
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :856.83
  • {Val1}-Exendin-3/4


    <p>{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.</p>
    Formule :NA
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3241.7
  • GLP-1R agonist 14

    CAS :
    <p>GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].</p>
    Formule :C45H42F2N10O5
    Couleur et forme :Solid
    Masse moléculaire :840.88
  • GIP/GLP-1 dual receptor agonist-1

    CAS :
    <p>Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.</p>
    Couleur et forme :Solid
  • HAEGTFTSDVS acetate


    <p>HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.</p>
    Formule :C50H75N13O22
    Degré de pureté :97.47%
    Couleur et forme :Solid
    Masse moléculaire :1210.2
  • GLP-1R agonist 29


    <p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>
    Couleur et forme :Odour Solid
  • Exendin-3/4 (59-86)


    <p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>
    Formule :NA
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3055.49
  • GLP-1(7-37)

    CAS :
    <p>GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.</p>
    Formule :C151H228N40O47
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3355.67
  • Mazdutide acetate(2259884-03-0 free base)


    <p>Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.</p>
    Degré de pureté :98.41%
    Couleur et forme :Odour Solid
  • Bay 55-9837

    CAS :
    <p>Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), &gt;1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.</p>
    Formule :C167H270N52O46
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3742.29
  • Semaglutide TFA


    <p>Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patients</p>
    Formule :C189H290F3N45O61
    Degré de pureté :99.69%
    Couleur et forme :Solid
    Masse moléculaire :4225.6482
  • Survodutide

    CAS :
    <p>Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.</p>
    Formule :C192H289N47O61
    Degré de pureté :99.83%
    Couleur et forme :Solid
    Masse moléculaire :4229.0957
  • VU0453379 hydrochloride


    <p>VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.</p>
    Formule :C26H35ClN4O2
    Couleur et forme :Solid
    Masse moléculaire :471.03
  • 3-Deoxyglucosone

    CAS :
    <p>3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with protein</p>
    Formule :C6H10O5
    Degré de pureté :95%
    Couleur et forme :Solid
    Masse moléculaire :162.14
  • Sorbinicate

    CAS :
    <p>Sorbinicate is an antihypercholesterolaemic and vasodilating nicotinic acid ester.</p>
    Formule :C42H32N6O12
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :812.74
  • Albiglutide fragment TFA


    <p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>
    Formule :C148H224N40O45·xC2HF3O2
    Couleur et forme :Solid
  • (R)-V-0219 hydrochloride


    <p>(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.</p>
    Formule :C20H26ClF3N4O2
    Couleur et forme :Solid
    Masse moléculaire :446.89
  • Maridebart

    CAS :
    <p>Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].</p>
    Couleur et forme :Liquid
  • Oxyntomodulin

    CAS :
    <p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>
    Formule :C192H295N59O60S
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :4421.86
  • GLP-1 receptor agonist 8

    CAS :
    <p>GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.</p>
    Formule :C34H36ClFN6O4
    Couleur et forme :Solid
    Masse moléculaire :647.14
  • [Des-His1,Glu9]-Glucagon amide

    CAS :
    <p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>
    Formule :C148H221N41O47S
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :3358.68
  • GLP-1R agonist 27


    <p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>
    Formule :C32H33N5O4Se
    Couleur et forme :Solid
    Masse moléculaire :630.6
  • (S)-V-0219 hydrochloride


    <p>(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.</p>
    Formule :C20H26ClF3N4O2
    Couleur et forme :Solid
    Masse moléculaire :446.89
  • GLP-1R agonist 15

    CAS :
    <p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>
    Formule :C46H47FN8O7S
    Couleur et forme :Solid
    Masse moléculaire :874.98
  • Gulgafafusp alfa

    CAS :
    <p>Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].</p>
    Couleur et forme :Liquid
  • Anti-GLP-1R Antibody


    <p>Anti-GLP-1R Antibody is an anti-GLP-1R antibody that can be used for immunohistochemistry of paraffin sections.</p>
    Degré de pureté :98.3% (SDS-PAGE); 97.2% (SEC-HPLC) - 98.3% (SDS-PAGE); 97.2% (SEC-HPLC)
    Couleur et forme :Odour Liquid
  • SPN009


    <p>SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.</p>
    Formule :C191H299N45O59
    Masse moléculaire :4167.17798
  • Glucagon-like peptide 1 (1-37), human TFA


    <p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>
    Formule :C188H276N51F3O61
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :4283.5
  • GLP-1R agonist 20


    <p>GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.</p>
    Formule :C31H30Cl2F2N4O5
    Masse moléculaire :646.15613
  • GLP-1R agonist 16

    CAS :
    <p>Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].</p>
    Formule :C50H58FN10O6P
    Couleur et forme :Solid
    Masse moléculaire :945.03
  • GLP-1R agonist 4

    CAS :
    <p>GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.</p>
    Formule :C32H30ClF2N3O5
    Couleur et forme :Solid
    Masse moléculaire :610.05
  • SAR441255


    <p>SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptors</p>
    Couleur et forme :Odour Solid
  • FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS


    <p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>
    Couleur et forme :Solid
    Masse moléculaire :3692.15
  • Dapiglutide

    CAS :
    <p>Dapiglutide (ZP7570) is a long-acting GLP-1R &amp; GLP-2R dual agonist for SBS research.</p>
    Couleur et forme :Solid
  • GRPP (human)

    CAS :
    <p>GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.</p>
    Formule :C136H215N41O58S
    Couleur et forme :Solid
    Masse moléculaire :3384.47
  • Glucagon (1-29), bovine, human, porcine

    CAS :
    <p>Corynoxine B (Cory B) is a naturally occurring alkaloid isolated from Uncaria rhynchophylla (Miq. ) and is an autophagy inducer.</p>
    Formule :C153H225N43O49S
    Degré de pureté :99.56% - 99.56%
    Couleur et forme :Solid
    Masse moléculaire :3482.75
  • GLP-1 receptor agonist 7

    CAS :
    <p>GLP-1 receptor agonist 7, potential for diabetes research, from patent WO2021219019A1.</p>
    Formule :C31H30ClFN4O5
    Couleur et forme :Solid
    Masse moléculaire :593.05
  • GLP-1 receptor agonist 2

    CAS :
    <p>GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>
    Formule :C30H31ClFN5O4
    Couleur et forme :Solid
    Masse moléculaire :580.05
  • V-0219

    CAS :
    <p>V-0219 is a positive allosteric modulator of GLP-1 and can be used in studies about obesity-associated diabetes.</p>
    Formule :C20H25F3N4O2
    Degré de pureté :99.91%
    Couleur et forme :Soild
    Masse moléculaire :410.43
  • GLP-1R modulator C16

    CAS :
    <p>GLP-1R modulator C16 is a variable modulator that significantly increases the binding affinity of GLP-4.</p>
    Formule :C21H26ClFN2O3
    Degré de pureté :99.6% - >99.99%
    Couleur et forme :Solid
    Masse moléculaire :408.89
  • Anti-GCGR Antibody (7J909)


    <p>Anti-GCGR Antibody (7J909) is an antibody targeting GCGR. Anti-GCGR Antibody (7J909) can be used in ELISA.</p>
    Couleur et forme :Odour Liquid
  • SCO-267

    CAS :
    <p>SCO-267 is a full agonist of GPR40/FFAR1, stimulating insulin secretion and GLP-1 release in diabetic rats, improving glucose tolerance,type 2 diabetes.</p>
    Formule :C36H46N4O5
    Degré de pureté :99.89%
    Couleur et forme :Solid
    Masse moléculaire :614.77
  • GLP-1R modulator C5

    CAS :
    <p>GLP-1R modulator C5 is a GLP-1R modulator that enhances GLP-1 binding to GLP-1R via transmembrane sites and can be used in the study of type II diabetes.</p>
    Formule :C24H21NO3
    Degré de pureté :99.59%
    Couleur et forme :Solid
    Masse moléculaire :371.43
  • Liraglutide

    CAS :
    <p>Liraglutide (Liraglutida) is a synthetic analog of GLP-1, an agonist of the GLP-1 receptor. Liraglutide is an antidiabetic agent. Cost effective and quality assured.</p>
    Formule :C172H265N43O51
    Degré de pureté :97.65% - 99.04%
    Couleur et forme :Solid
    Masse moléculaire :3751.25
  • PF-06882961 Tris

    CAS :
    <p>PF-06882961 Tris (UNII-2HJV78O0SS) is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>
    Formule :C35H41FN6O7
    Degré de pureté :98.74% - 99.79%
    Couleur et forme :Solid
    Masse moléculaire :676.7
  • GRA Ex-25

    CAS :
    <p>GRA Ex-25 (GRA-Ex-25) is an inhibitor of glucagon receptor.</p>
    Formule :C29H36F3N3O5
    Degré de pureté :98.2% - 98.88%
    Couleur et forme :Solid
    Masse moléculaire :563.61
  • Shanzhiside methyl ester

    CAS :
    <p>Shanzhiside methylester soothes neuropathic pain by triggering spinal GLP-1 receptors, boosting microglial β-endorphin through p38 MAPK.</p>
    Formule :C17H26O11
    Degré de pureté :98.998% - 99.32%
    Couleur et forme :Solid
    Masse moléculaire :406.38
  • Lixisenatide acetate (320367-13-3 free base)

    CAS :
    <p>Lixisenatide acetate is a receptor agonist similar to glucagon-like peptide-1 (glp-1) for the treatment of type 2 diabetes mellitus (T2DM).</p>
    Formule :C215H347N61O65S·6C2H4O2
    Degré de pureté :98% - 99.9%
    Couleur et forme :Solid
    Masse moléculaire :5218.88
  • BETP

    CAS :
    <p>BETP is an agonist of GLP-1 receptor (EC50s: 0.66 and 0.755 μM for human and rat GLP-1 receptor).</p>
    Formule :C20H17F3N2O2S
    Degré de pureté :98.51%
    Couleur et forme :Solid
    Masse moléculaire :406.42
  • HAEGTFTSDVSSYLE


    <p>HAEGTFTSDVSSYLE is a peptide. GLP-I analog contains the sequence.</p>
    Formule :C71H103N17O28
    Degré de pureté :>99.99%
    Couleur et forme :Solid
    Masse moléculaire :1642.71
  • GLP-1(7-36), amide

    CAS :
    <p>GLP-1 secretion by human enteroendocrine NCI-H716 cells is augmented in a dose-dependent manner by the addition of CPE.Cost-effective and quality-assured.</p>
    Formule :C149H226N40O45
    Degré de pureté :99.85%
    Couleur et forme :White Powder
    Masse moléculaire :3297.63
  • Exendin-4

    CAS :
    <p>Exenatide: GLP-1 receptor agonist, 39-amino acid, longer half-life (2.4 hrs), IC50 of 3.22 nM.</p>
    Formule :C184H282N50O60S
    Degré de pureté :97.71% - 99.78%
    Couleur et forme :Solid
    Masse moléculaire :4186.57
  • Semaglutide

    CAS :
    <p>Semaglutide is a glucagon-like peptide 1 receptor (GLP-1R) agonist(EC50 of 6.2 pM in a reporter assay using BHK cells expressing the human receptor).</p>
    Formule :C187H291N45O59
    Degré de pureté :96.92% - 99.78%
    Couleur et forme :Solid
    Masse moléculaire :4114
  • Exendin-4 acetate

    CAS :
    <p>Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).</p>
    Formule :C186H286N50O62S
    Degré de pureté :98.48% - 99.78%
    Couleur et forme :Solid
    Masse moléculaire :4247
  • Oxyntomodulin acetate


    <p>Oxyntomodulin acetate, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist[1].</p>
    Degré de pureté :99.24%
    Couleur et forme :Liquid
    Masse moléculaire :N/A
  • Bay 55-9837 acetate


    <p>Bay 55-9837 acetate is a potent and highly selective VPAC2 agonist(Kd = 0.65 nM) and can be used in type 2 diabetes studies.</p>
    Degré de pureté :98.27%
    Couleur et forme :Liquid
    Masse moléculaire :N/A
  • Secretin (33-59), rat

    CAS :
    <p>Secretin (33-59), rat (Secretin (rat)) is a classical hormone in the gastrointestinal system and a neuropeptide.</p>
    Formule :C129H216N42O42
    Degré de pureté :98.12%
    Couleur et forme :Solid
    Masse moléculaire :3027.35
  • Glucagon (19-29), human acetate


    <p>Glucagon (19-29), human acetate a COOH-terminal fragment processed from glucagon, is a potent and efficient inhibitor of insulin secretion.</p>
    Formule :C63H93N15O20S
    Degré de pureté :98.11%
    Couleur et forme :Solid
    Masse moléculaire :1412.57
  • HAEGTFT acetate(926018-95-3 free base)


    <p>HAEGTFT acetate is the first N-terminal 1-7 residues of GLP-1 peptide.</p>
    Formule :C35H51N9O14
    Degré de pureté :>99.99%
    Couleur et forme :Solid
    Masse moléculaire :821.84
  • Tirzepatide Acetate(2023788-19-2 free base)


    <p>Tirzepatide (LY3298176) Acetate (2023788-19-2 free base) is a new molecule that can control blood glucose levels.Cost-effective and quality-assured.</p>
    Formule :C227H352N48O70
    Degré de pureté :97.3% - 98.05%
    Couleur et forme :Solid
    Masse moléculaire :4873.5
  • Albiglutide TFA (782500-75-8 free base)


    <p>Albiglutide TFA (782500-75-8 free base) (Albiglutide TFA) is a long acting GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus (T2DM).</p>
    Formule :C150H225F3N40O47
    Degré de pureté :>99.99%
    Couleur et forme :Solid
    Masse moléculaire :3397.63
  • Teduglutide acetate


    <p>Teduglutide acetate, a GLP-2 analogue, maximizes small intestinal mucosal hypertrophy.</p>
    Formule :C166H256N44O56S
    Degré de pureté :97.39%
    Couleur et forme :Soild
    Masse moléculaire :3812.13
  • ML-SI3

    CAS :
    <p>CCG-143140 is a GLP-1 receptor inverse agonists.</p>
    Formule :C23H31N3O3S
    Degré de pureté :99.75%
    Couleur et forme :Solid
    Masse moléculaire :429.58
  • Exenatide

    CAS :
    <p>Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.</p>
    Formule :C186H286N50O62S
    Degré de pureté :99.42%
    Couleur et forme :Solid
    Masse moléculaire :4247
  • Glucagon-like peptide 1 (1-37), human acetate


    <p>Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist.</p>
    Degré de pureté :98%
    Couleur et forme :Liquid
    Masse moléculaire :N/A
  • Cotadutide acetate


    <p>Cotadutide acetate is a potent GLP-1 and glucagon receptor dual agonist with EC50s of 6.9 pM and 10.2 pM.</p>
    Formule :C169H256N42O57
    Degré de pureté :98.28%
    Couleur et forme :Solid
    Masse moléculaire :3788.14
  • GLP-1(7-37) acetate(106612-94-6 free base)

    CAS :
    <p>Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion.</p>
    Formule :C151H228N40O47
    Degré de pureté :98.89%
    Couleur et forme :Solid
    Masse moléculaire :3355.67
  • Avexitide

    CAS :
    <p>Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.</p>
    Formule :C149H234N40O47S
    Degré de pureté :98% - 99.65%
    Couleur et forme :Solid
    Masse moléculaire :3369.76
  • GLP-1 receptor agonist 9

    CAS :
    <p>1H-Benzimidazole-6-carboxylic acid is a GLP-1 receptor agonist.</p>
    Formule :C32H31ClFN3O5
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :592.06
  • PF-06291874

    CAS :
    <p>PF-06291874 (Glucagon receptor antagonists-4) (Glucagon receptor antagonists-4) is a highly effective and orally active antagonist of the glucagon receptor.</p>
    Formule :C26H28F3N3O4
    Degré de pureté :99.12% - 99.27%
    Couleur et forme :Solid
    Masse moléculaire :503.51
  • NNC-0640

    CAS :
    <p>NNC-0640 is a negative allosteric modulator of Human Glucagon Receptor with an IC50 of 69.2 nM.</p>
    Formule :C29H31N7O4S
    Degré de pureté :97.04%
    Couleur et forme :Solid
    Masse moléculaire :573.67
  • Glucagon receptor antagonists-5

    CAS :
    <p>Oral indazole-based glucagon antagonist, Ki: 32 nM, may treat type 2 diabetes.</p>
    Formule :C30H29ClF3N3O3
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :572.02
  • BAY-27-9955

    CAS :
    <p>BAY-27-9955 is a glucagon receptor antagonist.</p>
    Formule :C23H31FO
    Couleur et forme :Solid
    Masse moléculaire :342.49
  • (R)-V-0219


    <p>(R)-V-0219: GLP-1R PAM, orally active, triggers Ca++ flux in HEK-hGLP-1R cells.</p>
    Formule :C20H25F3N4O2
    Couleur et forme :Solid
    Masse moléculaire :410.43
  • GLP-1R agonist 1

    CAS :
    <p>GLP-1R agonist 1, an imidazole derivative and potent GLP-1R activator, may aid diabetes research.</p>
    Formule :C32H29ClFN3O5
    Couleur et forme :Solid
    Masse moléculaire :590.04
  • Glucagon receptor antagonists-2

    CAS :
    <p>Glucagon receptor antagonist -2 is a highly effective glucagon receptor antagonist.</p>
    Formule :C22H30FNO2
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :359.48
  • MS012

    CAS :
    <p>MS012 is a Potent and Selective Inhibitors for G9a-Like Protein (GLP) Lysine Methyltransferase (Kd = 46 ± 15 nM).</p>
    Formule :C22H35N5O2
    Couleur et forme :Solid
    Masse moléculaire :401.55
  • (S)-V-0219


    <p>(S)-V-0219: oral, GLP-1R PAM, boosts calcium in hGLP-1R HEK cells, lowers glucose, curbs hunger in mice.</p>
    Formule :C20H25F3N4O2
    Couleur et forme :Solid
    Masse moléculaire :410.43
  • GCGR antagonist 2

    CAS :
    <p>Orally active GCGR antagonist 2, a furan-2-carbohydrazide, binds hGluR at 2.3 nM. Blocks glucagon, inhibits rat receptor at 0.43 nM.</p>
    Formule :C28H26N4O2
    Couleur et forme :Solid
    Masse moléculaire :450.53
  • NNC 92-1687

    CAS :
    <p>NNC 92-1687 is a selective glucagon receptor antagonist that can be used to study type 2 diabetes.</p>
    Formule :C15H12N2O3S
    Degré de pureté :98.70% - 99.70%
    Couleur et forme :Solid
    Masse moléculaire :300.33
  • L-168049

    CAS :
    <p>L-168049: Human glucagon receptor antagonist, IC50 - 3.7 nM human, 63 nM murine, 60 nM canine.</p>
    Formule :C24H20BrClN2O
    Degré de pureté :>99.99%
    Couleur et forme :Solid
    Masse moléculaire :467.79
  • GLP-1R agonist 9

    CAS :
    <p>GLP-1R agonist 9 acts as a GLP-1R agonist, demonstrating efficacy with EC50 values of 1.1 nM and 11 nM against CHO GLP-1R Clone H6 and Clone C6, respectively.</p>
    Formule :C32H30ClF2N3O5
    Couleur et forme :Solid
    Masse moléculaire :610.05
  • GLP-1R agonist 17

    CAS :
    <p>GLP-1R agonist 17 excels in stimulating GLP-1 receptors, useful for cardiovascular metabolic disease research.</p>
    Formule :C28H26ClFN4O4S
    Couleur et forme :Solid
    Masse moléculaire :569.05
  • Glucagon receptor antagonists-3

    CAS :
    <p>Glucagon receptor antagonist -3 is a highly effective glucagon receptor antagonist.</p>
    Formule :C22H30FNO2
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :359.48
  • GLP-1 receptor agonist 3

    CAS :
    <p>GLP-1 receptor agonist 3 is a GLP-1 receptor agonist,Example 4A-1, has EC50s of 1.1 nM and 13 nM in Clone H6 and Clone C6 cell lines assay, respectively.</p>
    Formule :C31H30FN5O4
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :555.6
  • GLP-1R agonist 12

    CAS :
    <p>GLP-1R agonist 12 (Compound 123) 是一种 GLP-1R 激动剂,能够用于研究糖尿病。</p>
    Formule :C34H36N6O4
    Couleur et forme :Solid
    Masse moléculaire :592.69
  • LGD-6972 sodium

    CAS :
    <p>LGD-6972 sodium is a glucagon receptor antagonist.</p>
    Formule :C43H46N2NaO5S
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :725.9
  • Antitumor agent-101

    CAS :
    <p>Antitumor agent-101 is a selective, covalent inhibitor targeting lysine methyltransferases G9a/GLP, demonstrating IC50 values of 8.5 nM for G9a and 5.5 nM for</p>
    Formule :C26H38N6O3
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :482.62
  • MK 0893

    CAS :
    <p>MK 0893 is a potent and selective Glucagon Receptor (GR) antagonist competitive, reversible cAMP activity, which attenuates blood glucose elevation.</p>
    Formule :C32H27Cl2N3O4
    Degré de pureté :98.79%
    Couleur et forme :Solid
    Masse moléculaire :588.48
  • MK3577

    CAS :
    <p>MK3577 is a glucagon receptor antagonist.</p>
    Formule :C30H30ClFN2O3
    Couleur et forme :Solid
    Masse moléculaire :521.02
  • GLP-1R agonist 3

    CAS :
    <p>GLP-1R agonist 3 is a GLP-1R agonist, an imidazole derivative.GLP-1R agonist 3 can be used to study diabetes and obesity.</p>
    Formule :C31H28FN5O4
    Degré de pureté :97.19%
    Couleur et forme :Solid
    Masse moléculaire :553.58
  • GLP-1R agonist 10

    CAS :
    <p>GLP-1R agonist 10 is a GLP-1 agonist (EC50: 0.051 nM).</p>
    Formule :C29H29ClFN5O4
    Couleur et forme :Solid
    Masse moléculaire :566.02
  • LGD-6972

    CAS :
    <p>LGD-6972 is an antagonist of glucagon receptor.</p>
    Formule :C43H46N2O5S
    Degré de pureté :98.8% - 99.62%
    Couleur et forme :Solid
    Masse moléculaire :702.9
  • Lotiglipron

    CAS :
    <p>Lotiglipron (PF-07081532) is a GLP-1R agonist that lowers blood glucose and may be used in the study of type 2 diabetes mellitus (T2DM) and excess obesity.</p>
    Formule :C31H31ClN4O5
    Degré de pureté :98.3%
    Couleur et forme :Solid
    Masse moléculaire :575.05
  • Adomeglivant

    CAS :
    <p>Adomeglivant (LY2409021) is a potent and selective glucagon receptor antagonist. Which is used in clinical trial for type 2 diabetes mellitus.</p>
    Formule :C32H36F3NO4
    Degré de pureté :99.91%
    Couleur et forme :Solid
    Masse moléculaire :555.63
  • PF-06372222

    CAS :
    <p>PF-06372222: a small-molecule that modulates GCGR and antagonizes GLP-1R, affecting insulin and glucagon.</p>
    Formule :C26H28F3N5O3
    Degré de pureté :98%
    Couleur et forme :Solid
    Masse moléculaire :515.53
  • GLP-1 receptor agonist 11

    CAS :
    <p>GLP-1 Receptor Agonist 11 (compound 3) acts as an effective agonist for the GLP Receptor, finding use in research related to conditions like diabetes and non-alc. fatty liver disease [1].</p>
    Formule :C31H31ClFN3O4
    Couleur et forme :Solid
    Masse moléculaire :564.05
  • GLP-1 receptor agonist 16

    CAS :
    <p>GLP-1 receptoragonist 16 (Example 53) is a GLP-1 agonist applicable for research in diabetes, obesity, or diseases related to non-alcoholic steatohepatitis.</p>
    Formule :C33H31ClFN3O4
    Couleur et forme :Solid
    Masse moléculaire :588.068
  • GLP-1 receptor agonist 15

    CAS :
    <p>GLP-1 receptor agonist 15 (Example 4) is a GLP receptor agonist with an EC50 of 0.74 nM. It exhibits an IC50 of 10.1 μM against the hERG potassium ion channel. This compound is applicable for research in the diabetes field.</p>
    Formule :C32H31ClFN3O5
    Couleur et forme :Solid
    Masse moléculaire :592.057
  • SCH-900822

    CAS :
    <p>SCH-900822 is a potent and selective glucagon receptor antagonist.</p>
    Formule :C34H43Cl2N7O2
    Couleur et forme :Solid
    Masse moléculaire :652.66
  • GLP-1R agonist 8

    CAS :
    <p>GLP-1R agonist 8 is a potent agonist of GLP-1R (EC50 &lt; 2 nM).</p>
    Formule :C33H32N4O5
    Couleur et forme :Solid
    Masse moléculaire :564.63
  • DS79932728

    CAS :
    <p>DS79932728 is an orally active inhibitor of G9a and GLP, with IC50 values of 12.6 nM and 75.7 nM, respectively. It induces the production of γ-globin, thereby increasing fetal hemoglobin (HbF) levels. In cynomolgus monkey models, DS79932728 enhances the proportion of F-reticulocytes (F-rets) and shows good oral absorption characteristics.</p>
    Formule :C19H25N3O
    Couleur et forme :Solid
    Masse moléculaire :311.421
  • DA-302168S

    CAS :
    <p>DA-302168S is an orally active, selective GLP-1R agonist with an EC50 value of 1.32 nM. It promotes insulin secretion and has a hypoglycemic effect. Additionally, DA-302168S reduces food intake. It primarily activates GLP-1R in humans and monkeys, with minimal effect on GLP-1R in rats, mice, and dogs. DA-302168S can be used for research in type 2 diabetes and obesity.</p>
    Formule :C33H24ClF2N3O5
    Couleur et forme :Solid
    Masse moléculaire :616.011
  • LSN3318839

    CAS :
    <p>LSN3318839 is a potent and orally available glucagon-like peptide-1 receptor (GLP-1R) modulator.LSN3318839 enhances GLP-1R G-protein-coupled signaling and can</p>
    Formule :C26H23Cl2N3O2
    Degré de pureté :99.21%
    Couleur et forme :Solid
    Masse moléculaire :480.39