
Récepteur du glucagon
Les récepteurs du glucagon sont des GPCR qui médiatisent les effets du glucagon, une hormone impliquée dans la régulation de l'homéostasie du glucose en favorisant la dégradation du glycogène et la libération de glucose par le foie. Ces récepteurs sont essentiels dans la gestion des niveaux de sucre dans le sang et sont particulièrement intéressants dans l'étude du diabète et des troubles métaboliques. Les antagonistes des récepteurs du glucagon sont explorés comme traitements potentiels de l'hyperglycémie dans le diabète de type 2. Chez CymitQuimica, nous offrons une variété de modulateurs de récepteurs du glucagon de haute qualité pour soutenir vos recherches en endocrinologie, diabète et régulation métabolique.
194 produits trouvés pour "Récepteur du glucagon"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
TT-OAD2
CAS :TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.
Formule :C50H49Cl4N3O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :929.75GLP-2(1-33)(human)
CAS :GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.Formule :C165H254N44O55SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3766.19HAEGTFT
CAS :HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.Formule :C33H47N9O12Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :761.78GLP-1(7-36), amide acetate
CAS :GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.Formule :C151H230N40O47Degré de pureté :99.89%Couleur et forme :SolidMasse moléculaire :3357.68Apraglutide
CAS :Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.Formule :C172H263N43O52Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3765.25Dulaglutide
CAS :Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).Couleur et forme :SolidTaspoglutide
CAS :Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetesFormule :C152H232N40O45Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3339.763LSN3160440
CAS :LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.Formule :C27H27Cl2N3OCouleur et forme :SolidMasse moléculaire :480.43Secretin, porcine
CAS :Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.Formule :C130H220N44O41·xC2H4O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :N/ATT-OAD2 free base
CAS :TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.Formule :C50H47Cl2N3O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :856.83Des His1, Glu8 Exendin-4
Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.Formule :C179H277N47O59SDegré de pureté :99.92%Couleur et forme :SolidMasse moléculaire :4063.46{Val1}-Exendin-3/4
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.Formule :NADegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3241.7GLP-1R agonist 14
CAS :GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].Formule :C45H42F2N10O5Couleur et forme :SolidMasse moléculaire :840.88GIP/GLP-1 dual receptor agonist-1
CAS :Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.Couleur et forme :SolidMaridebart
CAS :Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].Couleur et forme :LiquidGLP-1R agonist 29
GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.Couleur et forme :Odour SolidExendin-3/4 (59-86)
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.Formule :NADegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3055.49GLP-1(7-37)
CAS :GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.Formule :C151H228N40O47Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3355.67HAEGTFTSDVS acetate
HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.Formule :C50H75N13O22Degré de pureté :97.47%Couleur et forme :SolidMasse moléculaire :1210.2Bay 55-9837
CAS :Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.Formule :C167H270N52O46Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3742.29Mazdutide acetate(2259884-03-0 free base)
Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.Degré de pureté :98.41%Couleur et forme :Odour SolidVU0453379 hydrochloride
VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.Formule :C26H35ClN4O2Couleur et forme :SolidMasse moléculaire :471.03Semaglutide TFA
Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patientsFormule :C189H290F3N45O61Degré de pureté :99.69% - 99.94%Couleur et forme :SolidMasse moléculaire :4225.6482Survodutide
CAS :Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.Formule :C192H289N47O61Degré de pureté :99.83%Couleur et forme :SolidMasse moléculaire :4229.0957Albiglutide fragment TFA
Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as aFormule :C148H224N40O45·xC2HF3O2Couleur et forme :Solid3-Deoxyglucosone
CAS :3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with proteinFormule :C6H10O5Degré de pureté :95%Couleur et forme :SolidMasse moléculaire :162.14(R)-V-0219 hydrochloride
(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.Formule :C20H26ClF3N4O2Couleur et forme :SolidMasse moléculaire :446.89Ribupatide
CAS :Ribupatide is a dual agonist of gastric inhibitory polypeptide (GIP) and glucagon-like peptide 1 (GLP-1) receptors and can be utilized in antidiabetic research.Couleur et forme :SolidOxyntomodulin
CAS :GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.Formule :C192H295N59O60SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4421.86GLP-1 receptor agonist 8
CAS :GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.Formule :C34H36ClFN6O4Couleur et forme :SolidMasse moléculaire :647.14[Des-His1,Glu9]-Glucagon amide
CAS :Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.Formule :C148H221N41O47SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3358.68GLP-1R agonist 27
GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).Formule :C32H33N5O4SeCouleur et forme :SolidMasse moléculaire :630.6Vensemaglutide
CAS :Vensemaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in research related to diabetes or other metabolic disorders.Formule :C214H337N49O67Masse moléculaire :4668.25(S)-V-0219 hydrochloride
(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.Formule :C20H26ClF3N4O2Couleur et forme :SolidMasse moléculaire :446.89GLP-1R agonist 15
CAS :GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .Formule :C46H47FN8O7SCouleur et forme :SolidMasse moléculaire :874.98GLP-1R agonist 26
CAS :Compound 1, also known as GLP-1R agonist 26, is an agonist of the glucagon-like peptide-1 receptor (GLP-1R) with an EC50 of <10 nM.Formule :C32H29FN6O4SCouleur et forme :SolidMasse moléculaire :612.67Liraglutide acetate
CAS :Liraglutide acetate is the acetate salt form of Liraglutide, which is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in the study of type 2 diabetes.Formule :C172H265N43O51·xC2H4O2Couleur et forme :SolidMasse moléculaire :3751.20 (free base)Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Formule :C188H276N51F3O61Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4283.5PHI-27 (porcine)
CAS :PHI-27 (porcine) is a porcine-derived peptide consisting of 27 amino acids, utilized in the identification of peptide hormones and other bioactive peptides [1].Formule :C136H216N36O40Couleur et forme :SolidMasse moléculaire :2995.39GLP-1R agonist 16
CAS :Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].Formule :C50H58FN10O6PCouleur et forme :SolidMasse moléculaire :945.03GLP-1R agonist 4
CAS :GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.Formule :C32H30ClF2N3O5Couleur et forme :SolidMasse moléculaire :610.05SAR441255
SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptorsCouleur et forme :Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Couleur et forme :SolidMasse moléculaire :3692.15Dapiglutide
CAS :Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.Couleur et forme :SolidGRPP (human)
CAS :GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.Formule :C136H215N41O58SCouleur et forme :SolidMasse moléculaire :3384.47GLP-1(28-36)amide TFA
GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.Formule :C56H86F3N15O11Couleur et forme :SolidMasse moléculaire :1202.37GLP-1(9-36)amide TFA
GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.Formule :C142H215F3N36O45Couleur et forme :SolidMasse moléculaire :3203.43DD202-114
CAS :DD202-114 is an effective and selective agonist of GLP1R. It promotes the accumulation of cAMP, reduces blood glucose levels, and decreases food intake. Additionally, DD202-114 holds potential for research in type 2 diabetes mellitus (T2DM) and obesity studies.Formule :C33H35FN4O5Couleur et forme :SolidMasse moléculaire :586.65Utreglutide
CAS :Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .Formule :C191H298N46O58Couleur et forme :SolidMasse moléculaire :4166.67Bay 55-9837 TFA
Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.Formule :C150H240F3ClN44O44Couleur et forme :SolidMasse moléculaire :3456.22

