Récepteur du glucagon
Les récepteurs du glucagon sont des GPCR qui médiatisent les effets du glucagon, une hormone impliquée dans la régulation de l'homéostasie du glucose en favorisant la dégradation du glycogène et la libération de glucose par le foie. Ces récepteurs sont essentiels dans la gestion des niveaux de sucre dans le sang et sont particulièrement intéressants dans l'étude du diabète et des troubles métaboliques. Les antagonistes des récepteurs du glucagon sont explorés comme traitements potentiels de l'hyperglycémie dans le diabète de type 2. Chez CymitQuimica, nous offrons une variété de modulateurs de récepteurs du glucagon de haute qualité pour soutenir vos recherches en endocrinologie, diabète et régulation métabolique.
194 produits trouvés pour "Récepteur du glucagon"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
[Des-His1,Glu9]-Glucagon amide
CAS :Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.Formule :C148H221N41O47SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3358.68GLP-1R agonist 27
GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).Formule :C32H33N5O4SeCouleur et forme :SolidMasse moléculaire :630.6Vensemaglutide
CAS :Vensemaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in research related to diabetes or other metabolic disorders.Formule :C214H337N49O67Masse moléculaire :4668.25(S)-V-0219 hydrochloride
(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.Formule :C20H26ClF3N4O2Couleur et forme :SolidMasse moléculaire :446.89GLP-1R agonist 15
CAS :GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .Formule :C46H47FN8O7SCouleur et forme :SolidMasse moléculaire :874.98GLP-1R agonist 26
CAS :Compound 1, also known as GLP-1R agonist 26, is an agonist of the glucagon-like peptide-1 receptor (GLP-1R) with an EC50 of <10 nM.Formule :C32H29FN6O4SCouleur et forme :SolidMasse moléculaire :612.67Liraglutide acetate
CAS :Liraglutide acetate is the acetate salt form of Liraglutide, which is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in the study of type 2 diabetes.Formule :C172H265N43O51·xC2H4O2Couleur et forme :SolidMasse moléculaire :3751.20 (free base)Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Formule :C188H276N51F3O61Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4283.5PHI-27 (porcine)
CAS :PHI-27 (porcine) is a porcine-derived peptide consisting of 27 amino acids, utilized in the identification of peptide hormones and other bioactive peptides [1].Formule :C136H216N36O40Couleur et forme :SolidMasse moléculaire :2995.39GLP-1R agonist 16
CAS :Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].Formule :C50H58FN10O6PCouleur et forme :SolidMasse moléculaire :945.03GLP-1R agonist 4
CAS :GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.Formule :C32H30ClF2N3O5Couleur et forme :SolidMasse moléculaire :610.05SAR441255
SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptorsCouleur et forme :Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Couleur et forme :SolidMasse moléculaire :3692.15Dapiglutide
CAS :Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.Couleur et forme :SolidGRPP (human)
CAS :GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.Formule :C136H215N41O58SCouleur et forme :SolidMasse moléculaire :3384.47GLP-1(28-36)amide TFA
GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.Formule :C56H86F3N15O11Couleur et forme :SolidMasse moléculaire :1202.37GLP-1(9-36)amide TFA
GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.Formule :C142H215F3N36O45Couleur et forme :SolidMasse moléculaire :3203.43DD202-114
CAS :DD202-114 is an effective and selective agonist of GLP1R. It promotes the accumulation of cAMP, reduces blood glucose levels, and decreases food intake. Additionally, DD202-114 holds potential for research in type 2 diabetes mellitus (T2DM) and obesity studies.Formule :C33H35FN4O5Couleur et forme :SolidMasse moléculaire :586.65Utreglutide
CAS :Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .Formule :C191H298N46O58Couleur et forme :SolidMasse moléculaire :4166.67Bay 55-9837 TFA
Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.Formule :C150H240F3ClN44O44Couleur et forme :SolidMasse moléculaire :3456.22
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
