Halogénures organiques
Dans cette catégorie, vous trouverez des molécules organiques contenant un ou plusieurs atomes d'halogène dans leur structure. Ces halogénures organiques incluent des composés bromés, iodés, chlorés et des halogénures cycliques. Les halogénures organiques sont largement utilisés en synthèse organique, en pharmaceutique, en agrochimie et en science des matériaux en raison de leur réactivité et de leur capacité à subir une variété de transformations chimiques. Chez CymitQuimica, nous offrons une sélection complète d'halogénures organiques de haute qualité pour soutenir vos applications de recherche et industrielles, garantissant une performance fiable et efficace dans vos projets synthétiques et analytiques.
Sous-catégories appartenant à la catégorie "Halogénures organiques"
20442 produits trouvés pour "Halogénures organiques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
4-Chloroanisole
CAS :4-Chloroanisole is a chlorinated aromatic compound that is used as an industrial solvent. It has been shown to have fungicidal activity and can be used in the production of polyurethanes. 4-Chloroanisole reacts with chlorine atoms, forming diphenyl ethers. It also reacts with argon gas to form isotopomers, which are important in the study of steric interactions. The hydroxyl ions present in water cause the formation of a solid catalyst from 4-chloroanisole and potassium chloride. This solid catalyst is then used for reactions such as Suzuki coupling reactions and cationic polymerization reactions. 4-Chloroanisole also has the ability to react with an aryl halide, forming an aromatic molecule or halides.Formule :C7H7ClODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :142.58 g/mol1-(5-Chloro-2-hydoxyphenyl)ethanone
CAS :1-(5-Chloro-2-hydoxyphenyl)ethanone is a potent inhibitor of the antiapoptotic protein survivin. It binds to the carbonyl group of the molecule, which is located on the intramolecular hydrogen bond surface. This leads to conformational changes in the molecule and ternary complex formation, which eventually leads to apoptosis protein aggregation and activation. 1-(5-Chloro-2-hydoxyphenyl)ethanone has been shown to inhibit prostate cancer cells and has also been studied in clinical trials for its anticancer properties.Formule :C8H7ClO2Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :170.59 g/molBig Endothelin-3 (22-41) amide (human) trifluoroacetate salt
CAS :Please enquire for more information about Big Endothelin-3 (22-41) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C102H156N30O31Degré de pureté :Min. 95%Masse moléculaire :2,298.51 g/mol2,4'-Difluorobenzophenone
CAS :2,4'-Difluorobenzophenone is a n-hexane recrystallized product of the reaction between phosgene and 2,4-dichlorobenzophenone. It is an inorganic chemical that can be used as a residue or uptake inhibitor in the manufacture of aluminum. 2,4'-Difluorobenzophenone reacts with triazole to form sulfide and fluorobenzoyl chloride. The industrial use of this compound is mostly limited to pharmaceuticals and dyes. 2,4'-Difluorobenzophenone is not known to have any adverse environmental effects because it does not bioaccumulate or biomagnify in food chains.Formule :C13H8F2ODegré de pureté :90%Couleur et forme :Clear LiquidMasse moléculaire :218.2 g/mol3-Fluorobenzyl bromide
CAS :3-Fluorobenzyl bromide is a fluorinated benzyl derivative that can be used as a fluorescent probe for the study of cellular uptake and metabolism. 3-Fluorobenzyl bromide has been shown to have potent inhibitory activity against the growth of cancer cells in culture. It has also been shown to reduce ischemia reperfusion injury in cardiac tissue. The pharmacokinetic properties of 3-fluorobenzyl bromide have been studied in detail, revealing a rapid uptake into cells and elimination by renal excretion. This compound also inhibits the growth of P. aeruginosa in an animal model, with no effect on other bacterial strains or mammalian cells.Degré de pureté :Min. 95%(Phe1,Ser2)-TRAP-6 trifluoroacetate salt
CAS :Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C34H56N10O9Degré de pureté :Min. 95%Masse moléculaire :748.87 g/mol2-(2-Ethoxyphenoxy)ethyl bromide
CAS :2-(2-Ethoxyphenoxy)ethyl bromide is a substance that is found as an impurity in the drug sulphonamide. It has been shown to be an optical isomer of methanol and ethanol, which have base form. The substance crystallizes in the form of white needles and its base form is tamsulosin hydrochloride. It has been used as a reagent for organic chemistry reactions, such as recrystallization, and as an impurity in organic solvents.
Formule :C10H13BrO2Degré de pureté :Min. 95%Masse moléculaire :245.11 g/molH-His-His-OH trifluoroacetate salt
CAS :H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.Formule :C12H16N6O3Degré de pureté :Min. 95%Masse moléculaire :292.29 g/mol2,3-Difluoro-5-(trifluoromethyl)pyridine
CAS :2,3-Difluoro-5-(trifluoromethyl)pyridine is a diluent that is used in organic synthesis. It is a nucleophilic and hydrogen fluoride (HF) activated fluoropyridine. This compound has a diameter of 190.7 pm and an anhydrous form. 2,3-Difluoro-5-(trifluoromethyl)pyridine can be prepared by condensing pyridine with fluorine gas in the presence of an activating agent such as HF or silver nitrate. This compound reacts when exposed to vapor or heat, releasing HF as a byproduct. The pyridine ring found in this compound contains six carbon atoms, two nitrogen atoms, and one oxygen atom.
Formule :C6H2F5NDegré de pureté :Min. 95%Masse moléculaire :183.08 g/mol(D-His2,D-Trp6)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (D-His2,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C64H82N18O13Degré de pureté :Min. 95%Masse moléculaire :1,311.45 g/molOxyntomodulin (human, mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about Oxyntomodulin (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C192H295N61O60SDegré de pureté :Min. 95%Masse moléculaire :4,449.84 g/molGliadorphin-7 trifluoroacetate salt
CAS :Gliadorphin is a peptide that occurs in cow's milk. It has been shown to be effective against bacterial translocation, which is the passage of bacteria from the gut into other parts of the body. Gliadorphin also has a safety profile, with no observed adverse effects in animal studies and dietary trials. The biological samples used for this study were casein and urine samples. The antibodies used were polyclonal antibodies and Gliadorphin was tested for its ability to bind to bacterial proteins in vivo. Hydration may be necessary for optimal absorption of gliadorphin, as dehydration can affect immune reaction. Gliadorphin does not have any known side effects or drug interactions, but it should not be used by people with an allergy to casein or those who are allergic to mammalian serine proteases (such as trypsin).Formule :C43H57N9O11Degré de pureté :Min. 95%Masse moléculaire :875.97 g/mol1,6-Diaminohexane dihydrochloride
CAS :1,6-Diaminohexane dihydrochloride is a chemical that is used in the analytical method for the determination of p-hydroxybenzoic acid. It has also been used to measure fatty acids and anhydrous sodium. The sample preparation required for this chemical includes mixing with water and adding hydroxyl groups. A toxicological study on 1,6-diaminohexane dihydrochloride shows that it has no acute toxicity in rats. However, it does show some signs of toxicity in rabbits and dogs at high doses. Amine compounds are usually very reactive due to the presence of a lone electron pair on nitrogen.
Formule :C6H18Cl2N2Degré de pureté :Min. 95%Masse moléculaire :189.13 g/mol2-(2,4-Difluorophenyl)-1-(1H-1,2,4-triazol-1-yl)-3-(4H-1,2,4-triazol-4-yl)propan-2-ol
CAS :Please enquire for more information about 2-(2,4-Difluorophenyl)-1-(1H-1,2,4-triazol-1-yl)-3-(4H-1,2,4-triazol-4-yl)propan-2-ol including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C13H12F2N6ODegré de pureté :Min. 95%Masse moléculaire :306.27 g/molH-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt
CAS :H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.Formule :C20H35N9O10SDegré de pureté :Min. 95%Masse moléculaire :593.61 g/molMca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C49H68N14O15Degré de pureté :Min. 95%Masse moléculaire :1,093.15 g/mol(R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid
CAS :(R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is an antibacterial agent that inhibits the enzyme acetylcholine esterase. This inhibition prevents the breakdown of acetylcholine, leading to increased levels of this neurotransmitter in the brain and an enhancement of cholinergic transmission. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid has been shown to be effective against bacterial strains resistant to β-lactam antibiotics. The synthesis of taxol as well as other β-amino acids has been demonstrated using a variety of enzymatic methods. A reaction scheme for the synthesis of nicotinic acetylcholine has also been proposed. (R)-3-Amino-4-(2,4,5-trifluorophenyl)butyric acid is a dipeptFormule :C10H10F3NO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :233.19 g/molTyr-(D-Dab 4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) trifluoroacetate salt
CAS :Please enquire for more information about Tyr-(D-Dab 4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C67H85N15O11Degré de pureté :Min. 95%Masse moléculaire :1,276.49 g/mol1-Chloro-3-iodobenzene
CAS :1-Chloro-3-iodobenzene is a chemical compound that is used in the synthesis of ceramics. It is a colorless solid with a melting point of 337℃ and has a molecular weight of 160.161 g/mol. 1-Chloro-3-iodobenzene can be synthesized by reacting zinc powder with ethylmagnesium chloride in the presence of an aluminium catalyst. This reaction produces 1-chloro-3-iodobenzene, which can then be reacted with carbonyl chloride to produce aminocarbonylation products. The chemical compound was first synthesized by Grignard reagents, which are organometallic compounds containing a carbon atom bonded to a magnesium ion. Kinetic studies have shown that 1-chloro-3-iodobenzene reacts with hydroxide ions to form fluorescent products, although it is not reactive towards water or ammonia.Formule :C6H4ClIDegré de pureté :Min. 95%Masse moléculaire :238.45 g/molH-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
Please enquire for more information about H-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%(D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt
CAS :Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C63H73N11O9S2Degré de pureté :Min. 95%Masse moléculaire :1,192.45 g/molCortistatin-29 (rat) trifluoroacetate salt
CAS :Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C161H240N46O41S2Degré de pureté :Min. 95%Masse moléculaire :3,540.05 g/molZ-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C30H43FN4O11Degré de pureté :Min. 95%Masse moléculaire :654.68 g/molMethyl 6-chloronicotinate
CAS :Methyl 6-chloronicotinate is a quinoline derivative that has been shown to have cytotoxic effects. This compound inhibits the DNA repair protein O6-alkylguanine-DNA alkyltransferase (O6-AGAT) and induces apoptosis by binding to the cation channel and inhibiting the influx of calcium ions, which leads to an increase in intracellular calcium levels. Methyl 6-chloronicotinate also inhibits cancer cell proliferation through its interaction with the voltage-gated sodium channels and potassium channels, which leads to cell death. The molecular modeling study revealed that methyl 6-chloronicotinate binds to a deep hydrophobic pocket on the surface of hct116 cells, indicating that this drug may be a potential anticancer agent.Formule :C7H6ClNO2Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :171.58 g/molGRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS :GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.Formule :C75H110N24O16S2Degré de pureté :Min. 95%Masse moléculaire :1,667.96 g/mol(Lys18)-Pseudin-2 trifluoroacetate salt
CAS :Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C122H203N37O32Degré de pureté :Min. 95%Masse moléculaire :2,700.15 g/mol3-Chlorophenyl acetic acid
CAS :3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.Formule :C8H7ClO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :170.59 g/mol3-Bromo-4-fluorophenol
CAS :3-Bromo-4-fluorophenol is a synthetic, water soluble, and stable compound with a variety of applications. It yields white crystals that are soluble in water, acetone, ethanol, ether, benzene, chloroform, and carbon tetrachloride. 3-Bromo-4-fluorophenol has been shown to have a number of structural modifications that may be advantageous for therapeutic purposes. The most prominent modification is the methylation of the phenolic hydroxyl group (functionalisation). This modification prevents the drug from reacting with nucleophilic sites on proteins and other biological molecules. 3-Bromo-4-fluorophenol interacts with methyltransferase enzymes in cancer cells to inhibit their activity. These methyltransferase enzymes are involved in cellular proliferation and proliferation signalling pathways that may lead to cancer cell death.Formule :C6H4BrFODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :191 g/molH-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh)
Please enquire for more information about H-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt
CAS :Please enquire for more information about Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C84H144N24O25Degré de pureté :Min. 95%Masse moléculaire :1,890.19 g/mol5-Bromo-2-nitropyridine
CAS :5-Bromo-2-nitropyridine is a hydrogen bond donor. It is an organic molecule with the chemical formula C5H5BrN3. The compound has been used in the synthesis of other molecules, such as nicotinic acetylcholine and mitochondrial membrane potential inhibitors. 5-Bromo-2-nitropyridine is also a good candidate for cancer treatment due to its ability to inhibit cell cycle progression at G2/M phase. 5-Bromo-2-nitropyridine can be synthesized by reacting 2,4,6-trinitrobenzenesulfonic acid with bromine and potassium carbonate in a reaction vessel at 200 °C for about 30 minutes.Formule :C5H3BrN2O2Couleur et forme :PowderMasse moléculaire :202.99 g/mol2-Chloro-3,4-dihydroxybenzoic acid
CAS :Cefepime is a broad-spectrum antibiotic that is used to treat bacterial infections. It inhibits cell wall synthesis by binding to the penicillin-binding proteins and interfering with the cross-linking of peptidoglycan. Cefepime has been shown to be active against gram-negative pathogens such as Aeruginosa, Stenotrophomonas maltophilia, and P. aeruginosa. Cefepime also inhibits the growth of gram-positive bacteria such as Staphylococcus aureus, Enterococcus faecalis, and Streptococcus pneumoniae. The chemical structure of cefepime is similar to that of other beta-lactam antibiotics like methicillin, oxacillin, cloxacillin, ampicillin, and amoxicillin. Cefepime has been shown to be effective in treating resistant gram-negative organisms such as Pseudomonas aeruginosa (P.Formule :C7H5ClO4Degré de pureté :Min. 95%Couleur et forme :White To Yellow To Light Brown SolidMasse moléculaire :188.56 g/mol5-Bromo-2-fluorobenzoic acid
CAS :5-Bromo-2-fluorobenzoic acid is a potential drug that can be used to treat diseases such as malaria. It is also used in the synthesis of fluorine compounds, such as fluoroarenes. 5-Bromo-2-fluorobenzoic acid is activated by deprotonation with butyllithium and reacts with chlorine to give the product of 5-bromo-2-chlorobenzoic acid. The reagent chlorotrimethylsilane may also be used for this reaction. Substitution of fluorine for chlorine at the 2 position yields the desired product, 5-bromo-2-(trifluoromethyl)benzoic acid. This compound is a useful intermediate for making other drugs, including those that are important for treating cancer and viral infections.Formule :C7H4BrFO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :219.01 g/molBenzyltrimethylammonium dichloroiodate
CAS :Benzyltrimethylammonium dichloroiodate (BTMD) is an aliphatic hydrocarbon with a molecular weight of 278.32 g/mol. It has a basic fibroblast growth factor and has been shown to have anti-inflammatory properties. BTMD has also been shown to have a kinetic, reactive, and aromatic hydrocarbon as well as a carboxyl group. BTMD is postulated to bind to the serine protease and inhibit its activity, which may be due to the carbonyl group.Formule :C10H16Cl2INDegré de pureté :Min. 95%Couleur et forme :Yellow solid.Masse moléculaire :348.05 g/molBromofluoroacetic Acid
CAS :Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.Formule :C2H2BrFO2Degré de pureté :Min. 95%Masse moléculaire :156.94 g/mol2-Chloro-4-Hydroxybenzyl alcohol
CAS :2-Chloro-4-hydroxybenzyl alcohol is an organic compound that has been shown to be soluble in aqueous alkali metal solutions, but insoluble in water. It is also insoluble in polymer solvents such as acetone and ethyl ether. 2-Chloro-4-hydroxybenzyl alcohol is a sugar alcohol with 3 hydroxyl groups. The molecule has a molecular weight of 150.17 g/mol, melting point of -123°C (-198°F), boiling point of 179°C (354°F), and refractive index of 1.5774 at 20°C (68°F). This chemical can be used in the synthesis of polyhydric alcohols such as glycerol or hexanol. 2-Chloro-4-hydroxybenzyl alcohol is not soluble in hydrochloric acid, benzene or chloroform, and does not react to form any esFormule :C7H7ClO2Degré de pureté :Min. 95%Masse moléculaire :158.58 g/mol(7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C208H308N54O61SDegré de pureté :Min. 95%Masse moléculaire :4,573.06 g/molBiotinyl-Tyr-Val-Ala-Asp-chloromethylketone
CAS :Please enquire for more information about Biotinyl-Tyr-Val-Ala-Asp-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C32H45ClN6O9SDegré de pureté :Min. 95%Masse moléculaire :725.25 g/mol2-Fluoro-6-methylbenzoic acid
CAS :Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H7FO2Degré de pureté :Min. 98 Area-%Couleur et forme :White PowderMasse moléculaire :154.14 g/mol4-Fluoro-4'-hydroxybiphenyl
CAS :4-Fluoro-4'-hydroxybiphenyl is a reactive chemical that belongs to the group of halogenated hydrocarbons. It is used in the synthesis of medicines and has been shown to have high viscosity. 4-Fluoro-4'-hydroxybiphenyl can be synthesized by reacting with chloride in the liquid phase, resulting in a viscous liquid. This compound has also been used as an intermediate for the synthesis of other compounds. 4-Fluoro-4'-hydroxybiphenyl is used as a ligand for metal complexes and reacts with phosphine to form a phosphine oxide, which is then converted into a crystal compound. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis.
Formule :C12H9FODegré de pureté :Min. 95%Masse moléculaire :188.2 g/mol3,5-Bis(trifluoromethyl)phenol
CAS :3,5-Bis(trifluoromethyl)phenol (3,5-TFMP) is a nucleophilic compound that is soluble in organic solvents. It has acidic properties and enhances the rate of nucleophilic substitution reactions. 3,5-Bis(trifluoromethyl)phenol has been shown to be a size-exclusion chromatography stationary phase for separation of organic compounds. 3,5-TFMP has also been shown to have magnetic resonance spectroscopy properties. This compound is stable in supercritical carbon dioxide and can be used as a gravimetric analysis reagent. 3,5-Bis(trifluoromethyl)phenol is also able to form hydrogen bonds with other molecules and has the ability to bind fluorine atoms.
Formule :C8H4F6ODegré de pureté :Min. 95%Couleur et forme :Colorless Clear LiquidMasse moléculaire :230.11 g/molH-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Perfluoro-N-(4-methylcyclohexyl)piperidine
CAS :Produit contrôléPerfluoro-N-(4-methylcyclohexyl)piperidine (4-FPP) is a fluorine compound that has been shown to inhibit the enzymatic activity of tyrosine kinases. It is a potent inhibitor of both human and murine tyrosine kinases, but it does not bind to bacterial tyrosine kinase domains. 4-FPP has been used in clinical studies as an anti-cancer drug, although it's clinical relevance remains unclear. It has also been shown to be effective against the influenza virus by inhibiting the synthesis of viral proteins that are involved in replication. The chemical structure of 4-FPP contains a carbonyl group that can react with other compounds through a photochemical process. This reaction is thought to result in the development of new drugs with similar biochemical properties to 4-FPP.
Formule :C12F23NDegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :595.1 g/mol1-(2,4-Dichlorophenyl)-1H-pyrrole-2,5-dione
CAS :Maleimide is a chemical compound with the molecular formula CH2=C(O)NHC(=O)CH2-CO2H. It is a reactive monomer that polymerizes in the presence of an initiator to form polymers. Maleimides are also used as cross-linking agents, and have been shown to be thermostable and stable at high temperatures. This particular maleimide is a colorless solid that has been shown to copolymerize with methyl methacrylate and other monomers to form thermally stable, hydrophobic polymers.Formule :C10H5Cl2NO2Degré de pureté :Min. 95%Masse moléculaire :242.06 g/molMaxadilan trifluoroacetate salt
CAS :Maxadilan trifluoroacetate salt is a low-potency drug that binds to the GABA receptor and affects the central nervous system. Maxadilan trifluoroacetate salt is structurally related to leishmaniasis, an infectious disease caused by protozoa of the genus Leishmania. Maxadilan trifluoroacetate salt has been shown to prevent the development of autoimmune diseases in mice, including systemic lupus erythematosus, experimental autoimmune encephalomyelitis, and collagen-induced arthritis. Maxadilan trifluoroacetate salt has also been shown to be effective against cutaneous lesions in mice infected with Leishmania major. The mechanism of action is not yet known but may be due to its ability to influence mitochondrial membrane potential or fatty acid metabolism.Formule :C291H466N86O94S6Degré de pureté :Min. 95%Masse moléculaire :6,865.73 g/molN-Allyl-n-(2-chloro-5-cyanophenyl)acetamide
CAS :N-Allyl-n-(2-chloro-5-cyanophenyl)acetamide is a fine chemical that is used as a building block in the synthesis of other compounds. It is also used in research and as a reagent or speciality chemical. N-Allyl-n-(2-chloro-5-cyanophenyl)acetamide has been shown to be an excellent intermediate for complex organic reactions, such as coupling reactions with amines, alcohols, and thiols. In addition, this compound can be used to form new scaffolds for biological studies.
Formule :C12H11ClN2ODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :234.68 g/molAngiotensin II trifluoroacetate salt
CAS :Angiotensin II is a peptide hormone that may act as a neurotransmitter or neuromodulator. It is one of the most important vasoconstrictor and aldosterone-secreting hormones produced by the renin-angiotensin system in mammals. Angiotensin II has been shown to stimulate cardiac contractility, increase vascular resistance, and regulate blood pressure. The effect of Angiotensin II on cardiac contractility is mediated through its binding to a response element in the promoter region of genes encoding for Ca2+ channels. This binding leads to increased Ca2+ influx into cardiac cells and increased myofibrillar Ca2+ sensitivity. Angiotensin II also activates reactive oxygen species (ROS) production, which causes injury to the renal tubular epithelium and induces tubulointerstitial injury in rats with diabetes. It also stimulates squamous cell carcinoma growth by inducing reactive oxygen species (ROS) production and activating signal trans
Formule :C50H71N13O12·xC2HF3O2Degré de pureté :Min. 95%Masse moléculaire :1,046.18 g/mol2-(3,4-Dichlorophenyl)ethanol
CAS :2-(3,4-Dichlorophenyl)ethanol is a high quality reagent for the synthesis of complex compounds, useful as an intermediate in organic synthesis and as a building block for speciality chemicals. This chemical is also used as a research chemical in the synthesis of versatile building blocks. It can be used as a reaction component in various reactions such as Suzuki coupling, Negishi coupling, Heck reaction, and Sonogashira coupling.Formule :C8H8Cl2ODegré de pureté :Min. 95%Masse moléculaire :191.05 g/molMonocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt
CAS :Please enquire for more information about Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H98N18O22Degré de pureté :Min. 95%Masse moléculaire :1,411.52 g/mol(2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate
CAS :Produit contrôléPlease enquire for more information about (2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C9H17NO2•C2HF3O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :285.26 g/molAmyloid beta-Protein (11-42) trifluoroacetate salt
CAS :Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C152H244N40O42SDegré de pureté :Min. 95%Masse moléculaire :3,335.87 g/molBombesin trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C71H110N24O18SDegré de pureté :Min. 95%Masse moléculaire :1,619.85 g/molCalcium chloride dihydrate
CAS :Calcium chloride dihydrate is a chemical compound that is used in the preparation of buffers, as well as in polymer synthesis and analytical chemistry. It is also used in the treatment of low blood calcium levels, which may occur from chronic kidney failure, malnutrition or malabsorption. Calcium chloride dihydrate has been shown to inhibit the proliferation of various cancer cells, including prostate cancer cells. This inhibition has been shown to be due to its ability to significantly cytotoxic effects on these cells. The cytotoxicity was found to be due to lysosomal membrane permeabilization and Ca2+ influx into the cell leading to apoptosis induction.Formule :CaCl2•(H2O)2Degré de pureté :Min. 95%Couleur et forme :White Clear LiquidMasse moléculaire :147.01 g/molH-Leu-2-chlorotrityl resin (200-400 mesh)
Please enquire for more information about H-Leu-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Mepiquat chloride
CAS :Mepiquat chloride is a non-selective inhibitor of plant growth, which blocks the synthesis of protein and RNA in plants by inhibiting the activity of enzymes involved in nitrogen metabolism. The optimum concentration for mepiquat chloride is 0.5 to 1.0 mM with a range of 0.1 to 10 mM. Mepiquat chloride can be extracted from kidney beans or purchased as an analytical reagent. Mepiquat chloride has been shown to inhibit the activities of various enzymes, including choline acetyltransferase, histidine decarboxylase, and glutamine synthetase, at concentrations below 0.5 mM. This inhibition was synergistic with other inhibitors such as 2-deoxyglucose and sodium azide. In addition, mepiquat chloride has been shown to inhibit cell growth and root formation in plant cells in culture at concentrations between 1 and 100 μM.Formule :C7H16ClNDegré de pureté :Min. 95%Masse moléculaire :149.66 g/molrac 3,11-dichloro-6,11-dihydro-6-methyl-dibenzo[c,f][1,2]thiazepine 5,5-dioxide
CAS :Racemic 3,11-dichloro-6,11-dihydro-6-methyl-dibenzo[c,f][1,2]thiazepine 5,5-dioxide is a hydrogen chloride salt of racemic 3,11-dichloro-6,11-dihydro-6-methyl dibenzo[c,f][1,2]thiazepine. Racemic 3,11 - dichloro - 6 , 11 - dihydro - 6 - methyl dibenzo [ c , f ] [ 1 , 2 ] thiazepine 5 , 5 - dioxide is used in the manufacture of high purity and high yield hydrogen chloride gas. Racemic 3,11 - dichloro - 6 , 11 - dihydro - 6 - methyl dibenzo [ c , f ] [ 1 , 2 ] thiazepine 5 , 5 - dioxide can be prepared by heating anhydFormule :C14H11Cl2NO2SDegré de pureté :Min. 95%Masse moléculaire :328.21 g/mol4-Amino-2-chloro-3-fluorobenzonitrile
CAS :Please enquire for more information about 4-Amino-2-chloro-3-fluorobenzonitrile including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C7H4ClFN2Degré de pureté :Min. 95%Masse moléculaire :170.57 g/mol3’’’-Epi-Empagliflozin
CAS :Please enquire for more information about 3’’’-Epi-Empagliflozin including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C23H27ClO7Degré de pureté :95% MinCouleur et forme :PowderMasse moléculaire :450.91 g/mol(R)-(+)-3-Chloro-1-phenyl-1-propanol
CAS :(R)-(+)-3-Chloro-1-phenyl-1-propanol is a substrate for the lactamase of bacteria. The immobilized lipase catalyzes the hydrolysis reaction in which the lactam ring is broken, yielding a propiophenone intermediate. This intermediate can be converted to (S)-(+)-3-chloro-1-phenylpropanol by treatment with an alcohol oxidase or by hydrolysis with hydrogen peroxide. The product has been shown to have antidepressant activity and may modulate the dry weight of bacteria. In vivo studies show that this compound has a high concentration in rats and mice, but it is not active in humans.Formule :C9H11ClODegré de pureté :Min. 95%Couleur et forme :White To Yellow SolidMasse moléculaire :170.64 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C221H368N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,121.8 g/molH-Ser(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
Please enquire for more information about H-Ser(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%3-Bromo-2-methyl-5-nitropyridine
CAS :Please enquire for more information about 3-Bromo-2-methyl-5-nitropyridine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C6H5BrN2O2Degré de pureté :Min. 95%Masse moléculaire :217.02 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS :Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C63H113N22O25PSDegré de pureté :Min. 95%Masse moléculaire :1,641.74 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C195H300N56O56SDegré de pureté :Min. 95%Masse moléculaire :4,356.88 g/molSpexin trifluoroacetate salt
CAS :Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C74H114N20O19SDegré de pureté :Min. 95%Masse moléculaire :1,619.89 g/molN1-Acetylspermidine dihydrochloride
CAS :N-Acetylspermidine dihydrochloride is a polyamine oxidase inhibitor that has been shown to be useful in the treatment of cancer. It inhibits the synthesis of ornithine and N-acetylornithine, which are intermediates in polyamine biosynthesis. Inhibition of polyamine biosynthesis may lead to a decrease in cellular proliferation and an increase in apoptosis. The effect of this drug on human tissues has been studied using high performance liquid chromatography (HPLC). This drug also inhibits the activity of human urine decarboxylase, leading to a decrease in urinary excretion of ornithine and increased urinary excretion of putrescine.
Formule :C9H23Cl2N3ODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :260.2 g/mol3-Bromopropylboronic acid pinacol ester
CAS :Please enquire for more information about 3-Bromopropylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C9H18BBrO2Degré de pureté :Min. 95%Masse moléculaire :248.95 g/molMethyl 5-bromo-2-nitrobenzoate
CAS :Please enquire for more information about Methyl 5-bromo-2-nitrobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Cinnamoyl chloride
CAS :Cinnamoyl chloride is an organic compound that can be synthesized in an asymmetric fashion. It is a metabolite of cinnamoyl-CoA and has been shown to have photochemical properties. Cinnamoyl chloride has also been shown to inhibit the growth of cervical cancer cells. This compound also has hydroxyl groups, which may act as an amide or receptor activator. Cinnamoyl chloride may be used for the treatment of infectious diseases such as chlamydia and mycoplasma.Formule :C9H7ClODegré de pureté :Min. 95%Couleur et forme :Slightly Yellow PowderMasse moléculaire :166.6 g/mol(2-Chloropyridin-4-yl)methanamine
CAS :2-Chloropyridin-4-yl)methanamine is a hydrogenated molecule that has been shown to inhibit the activity of certain cancer cells. It inhibits the expression of the enzyme molecules involved in the synthesis of DNA and RNA. 2-Chloropyridin-4-yl)methanamine also inhibits the hydrolysis of hydrogen chloride (HCl) to produce hydrogen (H2). This drug is used as an inhibitor for medicines that require acidic pH for absorption, such as HCl.Formule :C6H7ClN2Degré de pureté :Min. 95%Masse moléculaire :142.59 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C29H46N10O7Degré de pureté :Min. 95%Masse moléculaire :646.74 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS :Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C196H288N56O56SDegré de pureté :Min. 95%Masse moléculaire :4,356.79 g/molImidazo[1,2-a]pyridin-7-amine hydrobromide
CAS :Please enquire for more information about Imidazo[1,2-a]pyridin-7-amine hydrobromide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C7H8BrN3Degré de pureté :Min. 95%Masse moléculaire :214.06 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS :Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C53H106N30O11Degré de pureté :Min. 95%Masse moléculaire :1,339.6 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS :Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C80H138N26O24S2Degré de pureté :Min. 95%Masse moléculaire :1,912.24 g/mol1,3-Bis[4-chloro-3-(trifluoromethyl)phenyl]urea
CAS :Covid-19 is a drug repositioning agent that has been shown to be effective against a number of microorganisms, including influenza A virus (H1N1) and the pandemic strain. Covid-19 is an efficient antimicrobial agent with activity against both Gram-positive and Gram-negative bacteria, as well as fungi. Covid-19 has also been shown to have antiviral properties against the human rhinovirus type 2 (HRV2). Covid-19 can be used for wastewater treatment because it can eliminate a broad spectrum of microorganisms. It also has anti-inflammatory properties, which may make it useful in animal health applications. Covid-19 could also be used in ecological systems because it is not toxic to plants or animals. Covid-19 is synthetically produced and can bind to antibodies that are specific to certain viruses or bacteria. Covid-19 has no known toxicity in mammals.Formule :C15H8Cl2F6N2ODegré de pureté :Min. 95%Masse moléculaire :417.13 g/molL-Tyrosine methyl ester hydrochloride
CAS :L-Tyrosine methyl ester hydrochloride is a synthetic compound that has been shown to have anti-thrombotic and anti-inflammatory properties. In particular, L-Tyrosine methyl ester hydrochloride inhibits the activity of thrombin, which is an enzyme involved in the coagulation process. It has also been shown to be effective against solid tumours and cell cultures. L-Tyrosine methyl ester hydrochloride is used as a pharmaceutical preparation for the treatment of osteoarthritis, rheumatoid arthritis, and other inflammatory disorders. It is also used as a precursor in the synthesis of amino acid compounds such as L-DOPA.Formule :C10H14ClNO3Degré de pureté :Min. 95%Masse moléculaire :231.68 g/molEthyl 2-(chlorosulfonyl)acetate
CAS :Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :186.61 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS :Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C194H294N54O56Degré de pureté :Min. 95%Masse moléculaire :4,278.74 g/molBis(cyclopentadienyl)titanium (IV) dichloride
CAS :Bis(cyclopentadienyl)titanium (IV) dichloride is a cationic polymerization catalyst that has been used to produce polyolefins with high molecular weights. It is also an important component of solid catalysts for the production of butadiene and styrene. Bis(cyclopentadienyl)titanium (IV) dichloride is a potent carcinogen in animals and is mutagenic in bacteria. It has been shown to cause cancer in animal models, and has been shown to be mutagenic in bacterial mutation assay tests. Bis(cyclopentadienyl)titanium (IV) dichloride reacts with dimethylformamide and aromatic hydrocarbons to produce photochemical properties that can lead to skin irritation or sensitization. This compound also has hydroxyl groups, which can react with oxidants such as chlorine gas to form chlorohydrins, which are toxic compounds that may be carcinogenic.
Formule :C10H10TiCl2Degré de pureté :Min. 95%Couleur et forme :Red Clear LiquidMasse moléculaire :248.96 g/molDABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt
CAS :Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C73H97N17O18SDegré de pureté :Min. 95%Masse moléculaire :1,532.72 g/mol3-Chloro-4-(3-fluorobenzyloxy)aniline
CAS :3-Chloro-4-(3-fluorobenzyloxy)aniline is a potent inhibitor of the epidermal growth factor receptor (EGFR), which is a tyrosine kinase that plays an important role in the initiation and progression of cancer. The compound has been shown to inhibit the proliferation of human cancer cell lines, such as breast cancer and prostate cancer, by blocking EGFR signaling. 3-Chloro-4-(3-fluorobenzyloxy)aniline also inhibits the activity of other kinases, such as lapatinib and 2-amino-4-fluorobenzoic acid. This inhibition may be due to its ability to bind to the ATP binding site on these enzymes.Formule :C13H11ClFNODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :251.68 g/mol2-Chloro-3-methoxybenzaldehyde
CAS :Please enquire for more information about 2-Chloro-3-methoxybenzaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C8H7ClO2Degré de pureté :Min. 95%Masse moléculaire :170.59 g/mol(Arg8)-Conopressin G trifluoroacetate salt
CAS :Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C44H71N17O10S2Degré de pureté :Min. 95%Masse moléculaire :1,062.28 g/molSalusin-beta (human) trifluoroacetate salt
CAS :Please enquire for more information about Salusin-beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C115H176N32O21Degré de pureté :Min. 95%Masse moléculaire :2,342.83 g/molTetrabutylammonium fluoride trihydrate
CAS :Tetrabutylammonium fluoride trihydrate is an aromatic hydrocarbon with a hydroxyl group. It is soluble in water and has a strong inhibitory effect on chain reactions. Tetrabutylammonium fluoride trihydrate can be used to inhibit the oxidation of quinoline derivatives that are used as drugs or pesticides. It also has an inhibitory effect on thermodynamic data such as the heat of vaporization, heat capacity, and entropy. The addition of trifluoroacetic acid to an organic solution containing hydrogen bonding interactions increases the solubility of tetrabutylammonium fluoride trihydrate in the organic solutions.Formule :C16H36FN•(H2O)3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :315.51 g/molVIP (6-28) (human, mouse, rat) trifluoroacetate salt
CAS :VIP (6-28) (human, mouse, rat) trifluoroacetate salt H-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys -Lys-Tyr-Leu is a prophylactic agent that is used to prevent the development of intestinal peptide induced myocardial fibrosis. It has been shown to reduce the incidence and severity of cardiovascular diseases. VIP (6/28) has a vasoactive effect on the intestines and may also have an effect on the cardiovascular system.
Formule :C126H207N37O34SDegré de pureté :Min. 95%Masse moléculaire :2,816.29 g/molc4-Ethyl-2,3-dioxo-piperazine carbonyl chloride
CAS :c4-Ethyl-2,3-dioxo-piperazine carbonyl chloride is a chloroformate that is used in the synthesis of carbamates. It is used in the production of triphosgene, which is an intermediate for the production of herbicides and pesticides. The impurities found in this substance are n-hexane, flow rate, chloride, chloroformate and solvents. This product can be synthesized by reacting c4-ethyl-2,3-dioxopiperazine with carbon tetrachloride. The reaction time required to produce this product is 2 hours at a temperature between 100°C and 150°C. The optimum pH range for the reaction is 8 - 10.Formule :C7H9ClN2O3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :204.61 g/molBoc-Lys(2-chloro-Z)-PAM resin (200-400 mesh)
Please enquire for more information about Boc-Lys(2-chloro-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%(Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt
CAS :Please enquire for more information about (Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C120H206N44O35SDegré de pureté :Min. 95%Masse moléculaire :2,857.26 g/mol(Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
Please enquire for more information about (Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H84N16O12Degré de pureté :Min. 95%Masse moléculaire :1,209.4 g/mol1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole
CAS :1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole is an organic compound that is used in the synthesis of carboxylic acid derivatives. It is a synthetic intermediate, which can be converted to other compounds by intramolecular hydrogen bonding. The efficiency of this method has been shown through a number of experiments. In nature, 1-methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole may be found as a hydrogen bond donor.Formule :C7H5Cl3N2O3Degré de pureté :Min. 95%Masse moléculaire :271.48 g/mol1,1,2,3,3,3-Hexafluoro-1-propene oxidized polymd.
CAS :1,1,2,3,3,3-Hexafluoro-1-propene oxidized polymd. is a cosmetically active organic solvent that is used as an ingredient in cosmetic products. It is also used as a raw material for the production of polymer films. 1,1,2,3,3,3-Hexafluoro-1-propene oxidized polymd. has been shown to be effective in preventing calcium carbonate from agglomerating and provides a constant viscosity in water. This product can also be used as a film-forming polymer with anti-fogging properties. The product also has nutritional supplement properties and can be found in dietary supplements such as fish oil capsules or vitamin E pills.Degré de pureté :Min. 95%Couleur et forme :Clear Liquid(D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C64H82N18O13Degré de pureté :Min. 95%Masse moléculaire :1,311.45 g/mol3,5-Bis(trifluoromethyl)benzaldehyde
CAS :3,5-Bis(trifluoromethyl)benzaldehyde is a synthetic compound that has been shown to inhibit cancer cell growth. It is a chromatographic reagent and an intermediate in the production of pharmaceuticals. 3,5-Bis(trifluoromethyl)benzaldehyde was shown to bind to the amino group of proteins and inhibit the synthesis of protein inhibitors. This compound also binds to cholesterol esters and causes lipid peroxidation, leading to cell death in cancer cells.
Formule :C9H4F6ODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :242.12 g/molPAR-3 (1-6) amide (mouse) trifluoroacetate salt
CAS :Please enquire for more information about PAR-3 (1-6) amide (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C25H36N8O8Degré de pureté :Min. 95%Masse moléculaire :576.6 g/molPrion Protein (118-135) (human) trifluoroacetate salt
CAS :Please enquire for more information about Prion Protein (118-135) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C68H112N18O22S2Degré de pureté :Min. 95%Masse moléculaire :1,597.86 g/molErythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt
CAS :Please enquire for more information about Erythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C72H99N17O17S2Degré de pureté :Min. 95%Masse moléculaire :1,538.79 g/molFluorescein-6-carbonyl-Tyr-Val-Ala-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Tyr-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C45H50FN5O15Degré de pureté :Min. 95%Masse moléculaire :919.9 g/mol2-Bromo-5-chlorobenzaldehyde
CAS :2-Bromo-5-chlorobenzaldehyde is an industrial chemical that is used as a precursor for the production of other chemicals. It can be synthesized by reacting 3-chlorobenzaldehyde with sodium bromide in the presence of a catalyst. 2-Bromo-5-chlorobenzaldehyde has been shown to have high reactivity, and can be used as a catalyst to produce large amounts of organic compounds. This chemical can also be produced in large quantities by neutralizing alkalis with acid, which is an effective way to dispose of these hazardous substances.
Formule :C7H4BrClODegré de pureté :Min. 95%Masse moléculaire :219.46 g/mol
![(2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFA100028.webp&w=3840&q=75)
![rac 3,11-dichloro-6,11-dihydro-6-methyl-dibenzo[c,f][1,2]thiazepine 5,5-dioxide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFR27443.webp&w=3840&q=75)
![Imidazo[1,2-a]pyridin-7-amine hydrobromide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFI111192.webp&w=3840&q=75)
![1,3-Bis[4-chloro-3-(trifluoromethyl)phenyl]urea](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFB90218.webp&w=3840&q=75)
